KEGG   Homo sapiens (human): 283807
Entry
283807            CDS       T01001                                 

Gene name
FBXL22, Fbl22
Definition
(RefSeq) F-box and leucine rich repeat protein 22
  KO
K10288  F-box and leucine-rich repeat protein 22
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    283807 (FBXL22)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     283807 (FBXL22)
SSDB
Motif
Pfam: F-box-like F-box
Other DBs
NCBI-GeneID: 283807
NCBI-ProteinID: NP_976307
OMIM: 609088
HGNC: 27537
Ensembl: ENSG00000197361
Vega: OTTHUMG00000132905
Pharos: Q6P050(Tdark)
UniProt: Q6P050
Position
15q22.31
AA seq 247 aa
MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTEL
QKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLS
AVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAE
RPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFP
GADAFPQ
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtggccactgctcaccatgcacataacccagctcaaccgggagtgcctgctgcacctc
ttctccttcctagacaaggacagcaggaagagccttgccaggacctgctcccagctccac
gacgtgtttgaggaccccgcactctggtccctgctgcacttccgttccctcactgaactc
cagaaggacaacttcctcctgggcccggcactccgcagcctctccatctgctggcactcc
agccgcgtgcaggtgtgcagcattgaggactggctcaagagtgccttccagagaagcatc
tgcagccggcacgagagcctggtcaatgatttcctcctccgggtgtgcgacaggctttct
gctgtgcgctccccacggaggcgggaggcgcctgcaccgtcctcggggactccgatcgcc
gttggaccgaaatcacctcggtggggaggacctgaccactcggagttcgccgacttgcgc
tcgggggtgacgggggccagggctgccgcgcgcaggggtctggggagcctccgggcggag
cgacccagcgagaccccgccggctcccggagtgtcctggggaccgccacctccaggagcc
ccggtggtgatctcggtgaagcaggaggaggggaagcaggggcgcacgggcagaaggagc
caccgagccgctcctccttgcggttttgcccgcacgcgcgtctgcccgcccacctttcct
ggggcggatgcgttcccgcagtga

DBGET integrated database retrieval system