KEGG   Homo sapiens (human): 283869
Entry
283869            CDS       T01001                                 
Symbol
NPW, L8, L8C, PPL8, PPNPW
Name
(RefSeq) neuropeptide W
  KO
K23141  neuropeptide W
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    283869 (NPW)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    283869 (NPW)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (GPCR binding)
   283869 (NPW)
SSDB
Motif
Pfam: NPBW
Other DBs
NCBI-GeneID: 283869
NCBI-ProteinID: NP_001092926
OMIM: 607997
HGNC: 30509
Ensembl: ENSG00000183971
CPD: C16032 C16033
UniProt: Q8N729
Position
16:2019785..2020755
AA seq 165 aa
MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY
LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA
PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF
NT seq 498 nt   +upstreamnt  +downstreamnt
ctggcgtggcgcccaggggagcggggggctcccgcgagccggccgcggctggcactgctg
ctgcttctgctcctgctgccgctgccctccggcgcgtggtacaagcacgtggcgagtccc
cgctaccacacggtgggccgcgccgctggcctgctcatggggctgcgtcgctcaccctat
ctgtggcgccgcgcgctgcgcgcggccgccgggcccctggccagggacaccctctccccc
gaacccgcagcccgcgaggctcctctcctgctgccctcgtgggttcaggagctgtgggag
acgcgacgcaggagctcccaggcagggatccccgtccgtgcgccccggagcccgcgcgcc
ccagagcctgcgctggaaccggagtccctggacttcagcggagctggccagagacttcgg
agagacgtctcccgcccagcggtggaccccgcagcaaaccgccttggcctgccctgcctg
gcccccggaccgttctga

DBGET integrated database retrieval system