KEGG   Homo sapiens (human): 283899
Entry
283899            CDS       T01001                                 

Gene name
INO80E, CCDC95
Definition
(RefSeq) INO80 complex subunit E
  KO
K11669  INO80 complex subunit E
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    283899 (INO80E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    283899 (INO80E)
SSDB
Motif
Pfam: NBP1 DegS DUF733
Other DBs
NCBI-GeneID: 283899
NCBI-ProteinID: NP_775889
HGNC: 26905
Ensembl: ENSG00000169592
Vega: OTTHUMG00000132114
Pharos: Q8NBZ0(Tdark)
UniProt: Q8NBZ0
Position
16p11.2
AA seq 244 aa
MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY
ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL
QASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCP
VGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVI
DIPE
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaacgggccggcggacggcgaagtggactacaaaaaaaaataccggaatctgaagcgg
aagctcaagttcctcatctacgagcacgagtgcttccaggaggagctgaggaaagcgcaa
aggaaattactgaaggtgtcccgggacaagagtttcctcctagaccgacttctgcagtac
gagaacgtggatgaagactcttcggactcagatgccactgcatcatcagataacagcgag
acggaggggacacccaagttgtctgacacaccggcccctaagaggaagagaagccctccg
ctggggggcgccccctctccctccagcctctccctgcctccttcaacagggtttcccctt
caggcctccggggtcccctccccatacctgagctcgctggcctcctcccgctacccccca
ttcccttctgactacctggccctgcagctgcccgagcccagtcccctgaggcccaagcgg
gagaaacggccccgcctgccccggaaactcaagatggcggtgggaccccccgactgccct
gtgggagggccgctgaccttccctggccggggttctggggctggggtcgggacaaccctg
acccccctcccaccccctaagatgcccccccccacgatcctgagcacggtccctcggcag
atgttcagcgatgcaggtagcggggacgatgccttggatggagacgatgacctggtgatc
gacatcccggagtga

DBGET integrated database retrieval system