KEGG   Homo sapiens (human): 283927Help
Entry
283927            CDS       T01001                                 

Gene name
NUDT7
Definition
(RefSeq) nudix hydrolase 7
  KO
K17879  peroxisomal coenzyme A diphosphatase NUDT7 [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    283927 (NUDT7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     283927 (NUDT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 283927
NCBI-ProteinID: NP_001099133
OMIM: 609231
HGNC: 8054
Ensembl: ENSG00000140876
Vega: OTTHUMG00000176808
Pharos: P0C024(Tdark)
UniProt: P0C024
Structure
PDB: 

Position
16q23.1
AA seq 238 aa AA seqDB search
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVR
SEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTL
ITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNP
EDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgacttggtcttcccgaggagccagtcagaaacagtttgctagatgatgctaag
gcccgcttaagaaagtatgatattggaggcaaatattctcacttgccatataacaaatac
tccgtccttttgccattggtggctaaagaaggaaaactccatttgttgttcaccgtccgg
tcagagaagctaagaagggcccctggagaagtttgcttccctggaggtaagcgtgaccct
acagacatggatgatgcagccacagctctccgggaagcccaggaggaagtgggtctccgt
cctcaccaagtggaagttgtctgctgcctggtgccatgtcttattgatacagatacattg
ataactccatttgtgggtttaatagaccacaacttccaggcccagccgaatcctgctgaa
gttaaggatgtattcctggtgcctctggcctatttcctgcatccacaggtccatgaccag
cattacgtcacacgtcttggtcaccgttttattaatcatatctttgagtacacaaaccct
gaagacggtgtcacttaccagatcaagggaatgacggcaaaccttgcagtgttggtggcc
tttatcattttggaaaaaaaacccacctttgaggttcaatttaatcttaatgatgtatta
gcatcctctgaagagttattcctgaaggttcataaaaaagctacaagcaggttatga

DBGET integrated database retrieval system