KEGG   Homo sapiens (human): 283987
Entry
283987            CDS       T01001                                 
Symbol
HID1, 17orf28, C17orf28, DMC1, HID-1
Name
(RefSeq) HID1 domain containing
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Hid1 Dymeclin
Other DBs
NCBI-GeneID: 283987
NCBI-ProteinID: NP_085133
OMIM: 605752
HGNC: 15736
Ensembl: ENSG00000167861
Pharos: Q8IV36(Tdark)
UniProt: Q8IV36
Position
17:complement(74950742..74972759)
AA seq 788 aa
MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVRE
ESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWS
TVPGAGRGGQGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSC
EYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCST
ENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIVTLDHDSASSA
SPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPN
STKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMH
IGVFILLLLSGERNFGVRLNKPYSIRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPL
FDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSAAQNHHLVFFLLEVFNNII
QYQFDGNSNLVYAIIRKRSIFHQLANLPTDPPTIHKALQRRRRTPEPLSRTGSQEGTSME
GSRPAAPAEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPEPQQSLEDGSPAKGEPS
QAWREQRRPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDE
SEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPVWYDTDV
KLFEIQRV
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggggtcgaccgactccaagctgaacttccggaaggcggtgatccagctcaccaccaag
acgcagcccgtggaagccaccgatgatgccttttgggaccagttctgggcagacacagcc
acctcggtgcaggatgtgtttgcactggtgccggcagcagagatccgggccgtgcgggaa
gagtcaccctccaacttggccaccctgtgctacaaggccgttgagaagctggtgcaggga
gctgagagtggctgccactcggagaaggagaagcagatcgtcctgaactgcagccggctg
ctcacccgcgtgctgccctacatctttgaggaccccgactggaggggcttcttctggtcc
acagtgcccggggcagggcgaggagggcagggagaagaggatgatgagcatgccaggccc
ctggccgagtccctgctcctggccattgctgacctgctcttctgcccggacttcacggtt
cagagccaccggaggagcactgtggactcggcagaggacgtccactccctggacagctgt
gaatacatctgggaggctggtgtgggcttcgctcactccccccagcctaactacatccac
gatatgaaccggatggagctgctgaaactgctgctgacatgcttctccgaggccatgtac
ctgcccccagctccggaaagtggcagcaccaacccatgggttcagttcttttgttccacg
gagaacagacatgccctgcccctcttcacctccctcctcaacaccgtgtgtgcctatgac
cctgtgggctacgggatcccctacaaccacctgctcttctctgactaccgggaacccctg
gtggaggaggctgcccaggtgctcattgtcactttggaccacgacagtgccagcagtgcc
agccccactgtggacggcaccaccactggcaccgccatggatgatgccgatcctccaggc
cctgagaacctgtttgtgaactacctgtcccgcatccatcgtgaggaggacttccagttc
atcctcaagggtatagcccggctgctgtccaaccccctgctccagacctacctgcctaac
tccaccaagaagatccagttccaccaggagctgctagttctcttctggaagctctgcgac
ttcaacaagaaattcctcttcttcgtgctgaagagcagcgacgtcctagacatccttgtc
cccatcctcttcttcctcaacgatgcccgggccgatcagtctcgggtgggcctgatgcac
attggtgtcttcatcttgctgcttctgagcggggagcggaacttcggggtgcggctgaac
aaaccctactcaatccgcgtgcccatggacatcccagtcttcacagggacccacgccgac
ctgctcattgtggtgttccacaagatcatcaccagcgggcaccagcggttgcagcccctc
ttcgactgcctgctcaccatcgtggtcaacgtgtccccctacctcaagagcctgtccatg
gtgactgccaacaagttgctgcacctgctggaggccttctccaccacctggttcctcttc
tctgccgcccagaaccaccacctggtcttcttcctcctggaggtcttcaacaacatcatc
cagtaccagtttgatggcaactccaacctggtctacgccatcatccgcaagcgcagcatc
ttccaccagctggccaacctgcccacggacccgcccaccattcacaaggccctgcagcgg
cgccggcggacacctgagcccttgtctcgcaccggctcccaggagggcacctccatggag
ggctcccgccccgctgcccctgcagagccaggcaccctcaagaccagtctggtggctact
ccaggcattgacaagctgaccgagaagtcccaggtgtcagaggatggcaccttgcggtcc
ctggaacctgagccccagcagagcttggaggatggcagcccggctaagggggagcccagc
caggcatggagggagcagcggcgaccgtccacctcatcagccagtgggcagtggagccca
acgccagagtgggtcctctcctggaagtcgaagctgccgctgcagaccatcatgaggctg
ctgcaggtgctggttccgcaggtggagaagatctgcattgacaagggcctgacggatgag
tctgagatcctgcggttcctgcagcatggcaccctggtggggctgctgcccgtgccccac
cccatcctcatccgcaagtaccaggccaactcgggcactgccatgtggttccgcacctac
atgtggggcgtcatctatctgaggaatgtggacccccctgtctggtacgacaccgacgtg
aagctgtttgagatacagcgggtgtga

DBGET integrated database retrieval system