KEGG   Homo sapiens (human): 283989Help
Entry
283989            CDS       T01001                                 

Gene name
TSEN54, PCH2A, PCH4, PCH5, SEN54L, sen54
Definition
(RefSeq) tRNA splicing endonuclease subunit 54
  KO
K15326  tRNA-splicing endonuclease subunit Sen54
Organism
hsa  Homo sapiens (human)
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    283989 (TSEN54)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    283989 (TSEN54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_int_end_N2 tRNA_int_endo_N zf-RING_11
Motif
Other DBs
NCBI-GeneID: 283989
NCBI-ProteinID: NP_997229
OMIM: 608755
HGNC: 27561
Ensembl: ENSG00000182173
Vega: OTTHUMG00000179684
Pharos: Q7Z6J9(Tbio)
UniProt: Q7Z6J9
Position
17q25.1
AA seq 526 aa AA seqDB search
MEPEPEPAAVEVPAGRVLSARELFAARSRSQKLPQRSHGPKDFLPDGSAAQAERLRRCRE
ELWQLLAEQRVERLGSLVAAEWRPEEGFVELKSPAGKFWQTMGFSEQGRQRLHPEEALYL
LECGSIHLFHQDLPLSIQEAYQLLLTDHTVTFLQYQVFSHLKRLGYVVRRFQPSSVLSPY
ERQLNLDASVQHLEDGDGKRKRSSSSPRSINKKAKALDNSLQPKSLAASSPPPCSQPSQC
PEEKPQESSPMKGPGGPFQLLGSLGPSPGPAREGVGCSWESGRAENGVTGAGKRRWNFEQ
ISFPNMASDSRHTLLRAPAPELLPANVAGRETDAESWCQKLNQRKEKLSRREREHHAEAA
QFQEDVNADPEVQRCSSWREYKELLQRRQVQRSQRRAPHLWGQPVTPLLSPGQASSPAVV
LQHISVLQTTHLPDGGARLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDE
PVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDVGH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgagcccgagcccgcggccgtggaggttcccgcggggcgcgtgctcagcgcc
cgggagctcttcgccgcccgctcgcggtcgcagaagctgccccagcgctcgcatggcccc
aaggactttctgcccgacggctcggcagctcaggccgagcggctgcgccggtgccgggaa
gagctctggcagctgctggcagagcagcgcgtggagcgcctgggcagcttggtggctgcc
gagtggaggccagaagagggcttcgtggagttgaagtctcccgcgggcaaattctggcag
accatgggcttctcagagcagggccggcagcgccttcacccggaagaggccttgtatctt
ctggagtgtggctccatccacctcttccaccaagacctgccactgtctatccaggaagct
taccagctgctgctgaccgaccacactgtgaccttcctgcagtaccaggtcttcagccac
ctgaagaggttgggttatgtggttcgacgattccaaccaagctctgtcctgtccccgtat
gagaggcagcttaacctggatgccagcgtgcagcacttggaggatggagatggcaagaga
aagaggagcagctccagccctcggtccattaataagaaggccaaggccctggacaactcc
ctgcaacccaagagtctggcagcctccagcccacctccctgcagccagcccagccaatgc
ccagaggagaaaccccaggagtcaagccccatgaagggcccagggggcccctttcagctt
ctggggtccctgggccccagccctggcccggccagggagggggtggggtgcagctgggag
agtggcagagccgagaacggagtcacgggagccggtaagcggcgctggaacttcgagcag
atctccttccccaacatggcttcagacagccgccacacccttctgcgcgccccagcccca
gagctgctcccggccaacgtggctgggcgggagacagacgctgagtcctggtgccagaag
ctgaaccagcgcaaggagaagctctccaggcgggaacgggagcaccacgcggaggccgcg
cagttccaggaagatgtcaacgccgatcccgaggtgcagcggtgctccagctggcgggag
tacaaggagctgctgcagcggcggcaggtgcagaggagccagcgccgggcccctcacctg
tggggccagcccgtcaccccgctgctgagtcctggccaggccagctccccagccgtggtc
cttcagcatatctctgtgctgcagacaacacaccttcctgatggaggtgcccggctgttg
gagaagtctgggggcttggaaatcatctttgatgtttaccaggccgacgctgtggccaca
ttccgaaagaataaccctggcaaaccctatgcccggatgtgcattagtggatttgatgag
cctgtcccagacctctgcagcctcaagcggttgtcttaccagagtggggatgtccctctg
atctttgccctggtggatcatggtgacatctccttctacagcttcagggacttcacgttg
ccccaggatgtggggcactga

DBGET integrated database retrieval system