KEGG   Homo sapiens (human): 283991
Entry
283991            CDS       T01001                                 
Symbol
UBALD2, FAM100B
Name
(RefSeq) UBA like domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UBA_4 TAP_C Replic_Relax
Other DBs
NCBI-GeneID: 283991
NCBI-ProteinID: NP_872371
HGNC: 28438
Ensembl: ENSG00000185262
Pharos: Q8IYN6(Tdark)
UniProt: Q8IYN6
Structure
Position
17:76265348..76271298
AA seq 164 aa
MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQ
MMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSH
QAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggtgaacatggacgagctgcggcaccaggtcatgatcaaccagttcgtgctggcc
gcgggctgcgcggccgaccaggcgaagcagttgctgcaggcggcccactggcagttcgag
accgcgctgagcacgttcttccaagaaaccaacattcccaacagccaccaccaccaccag
atgatgtgcactcccagcaacacccctgccacgccgcccaacttccccgatgcgctggcc
atgttctccaagctccgcgcctccgagggcctgcagagcagcaacagccccatgacagcc
gcagcctgctccccacctgcaaacttcagccccttctgggcctcgtccccgcccagccac
caggcgccctggatcccgccctcctcccccaccaccttccaccacctccaccgcccacag
cccacgtggcccccaggagcacagcaggggggcgcccagcagaaagccatggcggccatg
gacggccagagatga

DBGET integrated database retrieval system