KEGG   Homo sapiens (human): 283999
Entry
283999            CDS       T01001                                 
Symbol
TMEM235, ARGM1
Name
(RefSeq) transmembrane protein 235
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin SUR7
Other DBs
NCBI-GeneID: 283999
NCBI-ProteinID: NP_001191139
OMIM: 620272
HGNC: 27563
Ensembl: ENSG00000204278
UniProt: A6NFC5
Position
17:78231293..78240987
AA seq 223 aa
MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWR
ICEGQNGCIPLVDPFASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLA
QSVSLLLFTGCYFLLGSVLTLAGVSIYISYSHLAFAETVQQYGPQHMQGVRVSFGWSMAL
AWGSCALEAFSGTLLLSAAWTLSLSPPICGHLSPQQVGGRGGD
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcccggctgggcgcgctgctcctggccgccgccctgggtgcactgctcagcttcgcg
ctcctggccgccgcggtcgccagcgactactggtacatcctggaggtggcggacgccggc
aatggcagcgcctggcccgggcgcgcagagctgctctcctcgcactcggggctctggcgc
atctgcgaagggcagaacggctgcatcccgctggtcgacccttttgccagtgagagcctg
gacgtctccacctcggtgcagcacctcatcttgctgcaccgtgcagtcattgtggtcctg
cccctgagcctggtccttctcgtgtgtggctggatctgcggcctgctcagctccctggcc
cagagcgtgtctctgctgcttttcaccggctgctacttcctgctggggagtgtcctgaca
ctggcgggggtcagcatctacatcagctactcgcacctggcctttgcggagacggtgcag
cagtatggcccgcagcacatgcagggcgtccgcgtcagcttcggctggtccatggccctg
gcctggggctcctgtgccttggaggcattcagcggaaccctcctgctctcagctgcctgg
accctcagcctgagccccccaatctgtggtcatctgagtccccagcaggtgggagggaga
gggggagactga

DBGET integrated database retrieval system