KEGG   Homo sapiens (human): 284001Help
Entry
284001            CDS       T01001                                 

Gene name
CCDC57
Definition
(RefSeq) coiled-coil domain containing 57
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TolA_bind_tri Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 284001
NCBI-ProteinID: NP_932348
HGNC: 27564
Ensembl: ENSG00000176155
Vega: OTTHUMG00000140396
Pharos: Q2TAC2(Tdark)
UniProt: Q2TAC2
Position
17q25.3
AA seq 915 aa AA seqDB search
MLPLGSEPALNELLLRKEEEWRALQAHRTQLQEAALQDTRSQLEEAQGKLRCLQEDFVYN
LQVLEERDLELERYDAAFAQAREWEEARRAEVSELKIEAAKLRQALAREARKVEELQQQQ
QLAFQEHRLELERVHSDKNGEIDHHREQYENLKWTLERKLEELDGELALQRQELLLEFES
KMRKREHEFRLQADNMSNTALSRELKVKLLHKELEALKEAGAKAAESLQRAEATNAELER
KLQSRAGELQDLEAMSRARVKDLEDKLHSVQLTRKKEEETFKRKHEELDRLAREKDAVLV
AVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDASTVK
SAWDAQIAQLSKEMVSRDLQIQTLQEEEVKLKAQVARSQQDIERYKQQLSLAVERERSLE
RDQVQLGLDWQRRCDDIERDQIQKSEALIQGLSMAKSQVAAKLQETEQALQEQEVVLKAV
TLERDQAVQALRMHGLPRPGAQMLLRQHEEEISKDFPSSEIQRLREQNTSLRNAIAQMRK
EMEALSHQIPPPIQTAAESTDANQPDPEAGGDAATPDYVLALEAEIRTLKHKFKTLEKHL
EDVLDPLKMSSPHAESQPSVRTSTETTGGSAQAGQAGGSVQAGQAGGSVQAGPVSSGLAL
RKLGDRVQLLNLLVTRLRQKVLREPLEPAALQRELPREVDQVHLEVLELRKQVAELGKHL
RIAQHGGAEPSGRKQPPASDAVALGREDAKSAEDEAPSRHLGKHQPRSAQVGSRLDALQG
PKTQHSIHTVTCKSPRQKEDRSPKPPQAPQHPEEHGRQSHSSSSFASGTLQDMWRLLDLG
SSPSGVTSQGDSTPELPAPPAADRRPVKMQAGIATPGMKTAAQAKAKTTGASRSHPAKAK
GCQRPPKIRNYNIMD
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgctgccactgggctcagagcccgccctgaatgagctgctgcttcgcaaggaggaggag
tggagggcgctgcaggcacaccgcacccagctgcaggaggcggctctgcaggacacacgg
agccagctggaggaggcgcaggggaaactgcggtgcctgcaggaggactttgtctacaac
cttcaggtgctggaggagcgggacctcgagctggagcgctatgacgccgccttcgcccag
gccagggagtgggaagaggccaggcgggcagaggtgagcgagctcaagatagaggcagct
aagctgaggcaggcgctagccagagaggccaggaaggtggaggagctgcagcagcagcag
cagctggcattccaggagcatcgcctggagctggagcgcgtccacagtgacaagaatggt
gagattgaccaccaccgggaacagtatgaaaatctaaaatggacactggagagaaaactt
gaggagctcgacggtgagcttgctctgcagagacaggaactgctgctggagtttgaatcg
aaaatgcggaagagggagcacgaattccgtctgcaggctgacaacatgagcaacacagcc
ttgtcccgggagcttaaggttaaactactgcacaaagagctggaggctctgaaggaagcc
ggggcaaaggctgcagagagtctgcagagggcagaggccaccaacgccgagctggagagg
aagctccagagccgagccggggagctccaggacctggaggccatgagccgcgcccgggta
aaggatttagaggataaacttcactctgtgcagctaaccaggaagaaggaagaggaaaca
tttaagaggaagcatgaggagctcgaccgtctggccagggagaaggatgcagtgctggtg
gcggtgaagggagcccacgtggagcagctgcaggagctgcagaccagggttctggagctg
caggcccactgcgagaccctcgaggcgcagctccgcagggcagagtggagacaggctgac
accgccaaggagaaggacgctgccattgaccaacttcgtgaagatgcatcaactgtaaaa
tctgcctgggatgctcaaattgctcaactatctaaggagatggtctccagagaccttcag
attcagacgctgcaggaagaagaggtgaagctcaaggcacaggtggcccgatcccagcag
gacattgaaaggtacaagcaacagctgtccctggcagtggaaagggagcggagcctggag
cgtgatcaggtgcagctgggcctggactggcagcgccgctgtgatgacattgaaagggac
cagatccaaaagtcagaggccctgattcagggtctgagcatggcaaaaagtcaggttgct
gccaagctgcaggagacagagcaggcgctacaggagcaggaggtggtgctgaaggccgtg
accctggaacgagaccaggccgtgcaggccctgaggatgcatgggctccccagaccaggg
gcacagatgcttctcaggcagcatgaagaagaaataagtaaagactttccatccagtgag
atccagcggctccgagagcagaacacgagcttgcgaaacgcgattgcccagatgaggaaa
gaaatggaggctctaagccatcagattcctcctcccatccagacagcggcagagagcaca
gatgcaaaccagcctgacccagaggctgggggagatgccgccactcctgattatgttctg
gcccttgaagcagaaatacgaactctaaagcataagtttaaaactctggaaaagcatcta
gaagatgtgttggatcctttaaagatgtcctcacctcatgctgagtctcagcccagcgtc
cgcacctcgacagagacgactggagggtctgcccaagctggtcaagccggagggtctgtc
caagctggtcaagcaggaggatctgtccaagctggcccagtatcctctggactggcactc
aggaagctcggggacagagtgcagctcctaaacctgctggtgacacgactcagacagaag
gtgctgcgggaacccctggagccggccgctctccagcgtgagcttccccgtgaggtggac
caggtacacctggaggttttggagctgcggaagcaggtggctgagctggggaagcatctc
aggatagcccagcacgggggagcggagccttcaggcaggaagcagcccccagcctcggac
gccgtggcccttgggagagaggacgccaagagtgccgaggatgaggctccttccagacac
ttgggaaagcaccagccccgctcagcacaggtgggcagcagacttgacgccctgcaaggc
ccgaagacacaacacagcatccacacggtgacctgtaaatcacctcggcagaaagaagac
aggtccccaaagccaccccaggctccccagcaccctgaggagcatggtcgccaatcccac
agctcctcctcctttgccagtggcaccctccaggacatgtggaggttgctagacctggga
tccagcccttctggtgtcacctcccagggtgactcaactccagagctcccagctcctcca
gcagccgacaggaggcccgtcaagatgcaggcaggcattgccaccccagggatgaagaca
gcagcccaggcaaaggccaagaccacaggagcctcccggtctcatcctgcaaaagctaaa
ggctgccagaggccccccaagatccgtaactacaacattatggactga

DBGET integrated database retrieval system