KEGG   Homo sapiens (human): 284069
Entry
284069            CDS       T01001                                 

Gene name
FAM171A2
Definition
(RefSeq) family with sequence similarity 171 member A2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPF0560 Adeno_E3_CR2 FAM163
Other DBs
NCBI-GeneID: 284069
NCBI-ProteinID: NP_940877
HGNC: 30480
Ensembl: ENSG00000161682
Vega: OTTHUMG00000132421
Pharos: A8MVW0(Tdark)
UniProt: A8MVW0
Position
17q21.31
AA seq 826 aa
MPPASGPSVLARLLPLLGLLLGSASRAPGKSPPEPPSPQEILIKVQVYVSGELVPLARAS
VDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASV
SLYLLPERPATLILYEDLVHILLGSPGARSQPLVQFQRRAARLPVSSTYSQLWASLTPAS
TQQEMRAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSE
TRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTFVSPQLGYWVAAMASPTAGL
VTITSGIQDIGTYHTIFLLTILAALALLVLILLCLLIYYCRRRCLKPRQQHRKLQLSGPS
DGNKRDQATSMSQLHLICGGPLEPAPSGDPEAPPPGPLHSAFSSSRDLASSRDDFFRTKP
RSASRPAAEPSGARGGESAGLKGARSAEGPGGLEPGLEEHRRGPSGAAAFLHEPPSPPPP
FDHYLGHKGAAEGKTPDFLLSQSVDQLARPPSLGQAGQLIFCGSIDHLKDNVYRNVMPTL
VIPAHYVRLGGEAGAAGVGDEPAPPEGTAPGPARAFPQPDPQRPQMPGHSGPGGEGGGGG
GEGWGAGRAAPVSGSVTIPVLFNESTMAQLNGELQALTEKKLLELGVKPHPRAWFVSLDG
RSNSQVRHSYIDLQAGGGARSTDASLDSGVDVHEARPARRRPAREERERAPPAAPPPPPA
PPRLALSEDTEPSSSESRTGLCSPEDNSLTPLLDEVAAPEGRAATVPRGRGRSRGDSSRS
SASELRRDSLTSPEDELGAEVGDEAGDKKSPWQRREERPLMVFNVK
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgccgccggcgagtggccccagcgtcctcgcgcggctgttgccgctgctggggctgctg
ctcggcagcgcctcccgggctcccggcaagtcgccgccggagccccccagcccgcaggag
atcctgatcaaggtgcaggtgtatgtgagcggggagctggtgcccctggcccgggcctca
gtggatgtgtttgggaaccggactctgctggcagctggcaccacagactcagagggtgtg
gccaccctgcccctcagttatcgcttgggcacctgggtgctggtcactgctgcccgccct
ggcttcctcaccaactctgtgccctggcgtgttgacaagctgcccttgtatgcgtctgtc
agcctctacctgctccctgagcggccggccacgctcatcctctatgaggacctggtgcac
attctcctaggctctcccggtgcccgctcccagcccttggtgcagttccagcgccgggct
gcccgcctgcctgtcagctccacctacagccagctctgggcgtcacttacgcctgccagc
acccagcaggaaatgcgggctttccctgccttcctgggcactgaggcctccagctcaggc
aatggctcctggctggagctgatgcccctgactgctgtgagcgtgcacctgctgacaggt
aatgggacagaggtgccgctctcaggccccattcacctgtccctgcccgtgccctccgag
actcgtgccctcaccgtgggcaccagcattccagcctggagatttgaccccaagagtggg
ctgtgggtgcgcaatggcactggtgtaatccggaaggaaggccggcagctctactggacc
ttcgtctccccccagctggggtactgggtggccgccatggcctcccccacggctgggctg
gtcaccatcacgtcgggcatccaggacatcggcacctaccacaccatcttcttgctcacc
atcctggcagccctggccctgctggtgcttatcctgctgtgtctgctcatctactactgc
cggaggcgctgcctgaagccgaggcaacagcaccgcaagctgcagctctcggggccctct
gacggtaacaaacgagaccaggccacctcgatgtcccagctccacctcatctgtggggga
cccctggaacccgccccgtcgggggaccccgaggctccgcctccaggccccctccactcg
gccttctccagctcccgggacttggcctcctcccgggatgacttcttccgcaccaagccg
cgctctgccagccgcccggccgccgagccttcgggtgcccgcgggggcgagagcgccggg
ctcaagggcgctcgctcggccgagggccccggcgggctggagcccggcctagaggagcac
cggcgggggccctcgggggctgcggccttcctgcacgagccgccctcgccgccgccgccc
ttcgaccactacctgggccacaagggggcggccgagggcaagacccccgacttcctgctg
tcgcagtcggtggaccagctggcgcggccgccgtcgctgggccaggcggggcagctcatc
ttctgcggctccatcgaccacctcaaggacaacgtctaccgcaacgtcatgcccaccctg
gtgatccccgcgcactacgtgcgcctcggcggcgaggcgggcgccgccggcgtgggcgac
gagccggccccgccggagggcacggcacccggcccggcgcgcgcttttccccagcccgac
ccccagcgcccgcagatgccgggccactcgggcccggggggcgagggcggcgggggcggc
ggcgagggctggggggccgggcgcgcggcgcccgtcagtggctcagtcaccatccctgtg
ctattcaacgagtccaccatggcgcagctcaacggggagctgcaggccctgaccgagaag
aagctgctggaactgggcgtgaagccgcacccgcgcgcctggttcgtgtccctcgacggg
cgctccaactcgcaagtgcgccactcttacatcgacctgcaggcgggcggcggggcacgc
agcaccgacgccagcctggactcgggcgtagatgtccacgaggcgcggcccgcgcgccgc
cggcccgcgagggaggagcgggagcgcgccccgcctgccgcgccgccgccgccgcccgcg
cccccgcgcctggcgctcagcgaggacacggagcccagcagcagcgagagccgcacgggc
ctctgctctccggaggacaactcgctgacgccgctgctggacgaggtggcggcgcccgag
ggccgggcggccacggtaccccgggggcggggccgcagccgcggggacagctcccgcagc
agcgccagcgagctgcggcgcgactcgctcaccagcccggaggacgagctgggggcggag
gtgggcgacgaggcgggagacaagaagagcccgtggcagcggcgggaggagcggccgctg
atggtgttcaacgtcaagtag

DBGET integrated database retrieval system