KEGG   Homo sapiens (human): 284083Help
Entry
284083            CDS       T01001                                 

Gene name
C17orf47
Definition
(RefSeq) chromosome 17 open reading frame 47
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4655 Vault_3 DUF5393
Motif
Other DBs
NCBI-GeneID: 284083
NCBI-ProteinID: NP_001033793
HGNC: 26844
Ensembl: ENSG00000181013
Vega: OTTHUMG00000179244
Pharos: Q8NEP4(Tdark)
UniProt: Q8NEP4
Position
17q22
AA seq 570 aa AA seqDB search
MVKTNKPGAKVAVSAQRGSEVTTNTSPQQGHGYVLASSHRSAAVSLNPSHRRSEAAHPTT
PHSASDYPRSVSLQSGPGHYAVPTPRGTETGPRTESSRHSSPHLKSQKTQTLASHASSRQ
WKVSPPREEAARRGSESKSGREVGHHASSIPDAKSTHQLSFQDQKNNLQSQILEDDPPSK
VQNPQGVRVPRRILSYPKDEAVQTEPIQRITTTSEIRSPRSPSLLEHGSSCVSADYQTAQ
RRVPVEESETGPYGPIPSKPKALYRNMNLDSLLKLSVLKDSDGVHRVSARVDPESLHKYS
AYPETKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHVTVPSVSEGSH
KSSMFVTPEPIYKQQTQKPPEITYMSQGPTPRYPELSQKPSIHAELELTPRPLPPRSLPR
YGPDSSWWPLLNPEVETPQSQLTTPDFEPKCSPSLDLLLSGFKIDSSPFCEDLKFQREKA
SLSPPSPPKEFPSWAPLSEVPQTPKHTCKQPIQRFTAFFLDVSEEMYNRVIWWLKGLCFS
LLWAHCGSLGDGRTGEEWHLCIYRAGSFRR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagacaaataaacctggggccaaggtagcggtttcagcacagagagggtctgag
gttactactaacacatcccctcagcagggacatgggtacgttcttgcctcaagccatcga
agtgctgcagtctccctgaacccttcccaccgaagatcagaagctgcacatcccaccact
ccccattcggcatcagactaccctcgatctgtctccctccagtcaggacctggacactat
gcagtacccactcctcggggaaccgagactggaccaagaacagaatcatcccgccattcc
tctccccatctaaagagccagaagactcagacactggcttcccatgcttcaagcagacaa
tggaaagttagtccacccagagaggaagcagcacgaagaggcagtgagagcaagtcaggg
cgcgaggtcggccatcatgcttcatcaatcccagatgccaaatctactcatcagttgagt
tttcaagaccagaagaataacttacaatcacaaatcttagaagatgacccaccatccaag
gtccagaacccccaaggagtcagagttccccgtaggattttgtcttacccaaaggatgaa
gcagtacaaactgagcccatccaaagaattacgactactagtgagatcagatctccaagg
agtccctctctcctagagcacggaagcagctgtgtctctgcagactatcagacagcccag
agaagggtccctgtagaagaatcagaaacaggtccttacggtccaattccttcaaaaccc
aaggccttgtataggaatatgaacttggactcattgctcaaactctctgtccttaaagat
tctgatggtgtacaccgagtttctgcacgggtagaccctgagtctcttcataagtattct
gcctatcctgaaaccaagccctccgcaaaggtcttagtatcatcacaggtggagtccaac
gtgaggaccccaatccgaggaaacagcgaggttggccgcagggtcaccatctccccaggg
gtacagtcagtagagccaactcaccatgtgacagttccatcagtgtctgagggctcccac
aagtcatccatgtttgttactccagagcccatctataaacagcaaacccaaaaaccccca
gaaattacttacatgtcccaaggacctacacccaggtatccagaactctcgcaaaagccc
tccatccatgcagaactggaactgacccctaggcccttgcctcctcggtccttacctagg
tacggacctgactcctcatggtggcccttgctgaatcctgaagttgaaacaccccaaagc
cagctgacaacaccggattttgagcctaagtgctctccttccctagatcttttattgtcc
ggttttaaaatagactctagccctttctgtgaggatctgaagttccagagagagaaggca
agcctatcaccaccatcaccaccaaaggagtttccaagttgggcaccactgagtgaagtg
ccacagacccccaagcacacctgcaaacaacccattcaaaggtttactgctttcttcctg
gatgtctctgaggaaatgtacaatcgtgtcatctggtggctaaaaggtctgtgcttttcc
ctcctatgggcccactgtgggagcttgggggatgggaggacaggtgaggagtggcatcta
tgtatctacagagctgggtcgtttaggagataa

DBGET integrated database retrieval system