KEGG   Homo sapiens (human): 284086
Entry
284086            CDS       T01001                                 

Gene name
NEK8, JCK, NEK12A, NPHP9, RHPD2
Definition
(RefSeq) NIMA related kinase 8
  KO
K20877  NIMA (never in mitosis gene a)-related kinase 8 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00537  Nephronophthisis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    284086 (NEK8)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    284086 (NEK8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     284086 (NEK8)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NEK family
   284086 (NEK8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    284086 (NEK8)
SSDB
Motif
Pfam: Pkinase RCC1 PK_Tyr_Ser-Thr RCC1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 284086
NCBI-ProteinID: NP_835464
OMIM: 609799
HGNC: 13387
Ensembl: ENSG00000160602
Vega: OTTHUMG00000179454
Pharos: Q86SG6(Tbio)
UniProt: Q86SG6
Position
17q11.2
AA seq 692 aa
MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPR
GPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPP
LGAGGGSLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSN
GCLGHGSLTDISQPTIVEALLGYEMVQVACGASHVLALSTERELFAWGRGDSGRLGLGTR
ESHSCPQQVPMPPGQEAQRVVCGIDSSMILTVPGQALACGSNRFNKLGLDHLSLGEEPVP
HQQVEEALSFTLLGSAPLDQEPLLSIDLGTAHSAAVTASGDCYTFGSNQHGQLGTNTRRG
SRAPCKVQGLEGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLGRRDEDAGLPRPVQL
DETHPYTVTSVSCCHGNTLLAVRSVTDEPVPP
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggagaagtacgagcggatccgagtggtggggagaggtgccttcgggattgtgcacctg
tgcctgcgaaaggctgaccagaagctggtgatcatcaagcagattccagtggaacagatg
accaaggaagagcggcaggcagcccagaatgagtgccaggtcctcaagctgctcaaccac
cccaatgtcattgagtactacgagaacttcctggaagacaaagcccttatgatcgccatg
gaatatgcaccaggcggcactctggctgagttcatccaaaagcgctgtaattccctgctg
gaggaggagaccatcctgcacttcttcgtgcagatcctgcttgcactgcatcatgtgcac
acccacctcatcctgcaccgagacctcaagacccagaacatcctgcttgacaaacaccgc
atggtcgtcaagatcggtgatttcggcatctccaagatccttagcagcaagagcaaggcc
tacacggtggtgggtaccccatgctatatctcccctgagctgtgtgagggcaagccctac
aaccagaagagtgacatctgggccctgggctgtgtcctctacgagctggccagcctcaag
agggctttcgaggctgcgaacttgccagcactggtgctgaagatcatgagtggcaccttt
gcacctatctctgaccggtacagccctgagcttcgccagctggtcctgagtctactcagc
ctggagcctgcccagcggccaccactcagccacatcatggcacagcccctctgcatccgt
gccctcctcaacctccacaccgacgtgggcagtgtccgcatgcggagggcagagaagtcc
gtggcccccagcaacacagggagcaggaccaccagtgtccgctgcagaggtatcccccgg
ggacctgtgaggccagccatcccaccaccactgtcgtcagtgtatgcctggggtggtggg
ctgggcacccccctgcggctgccaatgctcaacacagaggtggtccaggtggcagctggg
cgcacgcagaaagccggcgtcacgcgctctgggcgtctcatcctgtgggaggccccaccc
ctaggtgcaggcggaggcagtctccttcctggggcagtggagcagccacagccccagttc
atctcgcgtttcctggagggccagtcgggtgtgaccatcaagcacgtggcctgtggggac
ttcttcactgcctgcctgactgacagaggcatcatcatgacattcggcagcggcagcaat
gggtgcctaggccatggcagcctcactgacatcagccagcccaccattgtggaggctttg
ctgggctatgaaatggtgcaggtggcctgtggggcctctcacgtgctggccctgtccact
gagcgagaactatttgcctggggccgtggagacagcggcagactggggctaggcaccagg
gagtcccacagctgcccccagcaggtgcccatgcccccaggacaggaagctcagcgagtt
gtatgtggtatcgattcctccatgatcctcactgtgcctggccaagccctagcctgtggg
agcaacaggttcaacaagctgggcctggaccacctctccctgggggaggagcctgtcccc
caccagcaagtggaggaggccctgagcttcacactactaggctctgcacccctggaccag
gagcctctgctgagtatagacctgggcactgctcactcagctgctgtgactgcctcgggt
gattgctacacttttggcagcaatcagcacggacagttgggcaccaatactcgccgaggc
agtcgggcaccctgtaaggtccaaggccttgagggcatcaagatggcaatggtagcctgt
ggggatgccttcactgtagctattggggcagagagcgaagtgtactcttggggcaaaggg
gcgcgaggtcgattgggaaggagggatgaggatgccggactccctcggccagtgcagttg
gatgagacacacccttacacggtgacttccgtgtcctgttgccatggaaacaccctcctg
gctgttcgatcggtcacagatgagccggtccccccctga

DBGET integrated database retrieval system