KEGG   Homo sapiens (human): 2841
Entry
2841              CDS       T01001                                 

Gene name
GPR18
Definition
(RefSeq) G protein-coupled receptor 18
  KO
K08410  N-arachidonyl glycine receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2841 (GPR18)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Arachidonylglycine
    2841 (GPR18)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2841
NCBI-ProteinID: NP_001091670
OMIM: 602042
HGNC: 4472
Ensembl: ENSG00000125245
Vega: OTTHUMG00000017266
Pharos: Q14330(Tbio)
UniProt: Q14330 H9NIM1
Position
13q32.3
AA seq 331 aa
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY
MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY
MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY
LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ
VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV
MLYRNYLRSMRRKSFRSGSLRSLSNINSEML
NT seq 996 nt   +upstreamnt  +downstreamnt
atgatcaccctgaacaatcaagatcaacctgtcccttttaacagctcacatccagatgaa
tacaaaattgcagcccttgtcttctatagctgtatcttcataattggattatttgttaac
atcactgcattatgggttttcagttgtaccaccaagaagagaaccacggtaaccatctat
atgatgaatgtggcattagtggacttgatatttataatgactttaccctttcgaatgttt
tattatgcaaaagatgaatggccatttggagagtacttctgccagattcttggagctctc
acagtgttttacccaagcattgctttatggcttcttgcctttattagtgctgacagatac
atggccattgtacagccgaagtacgccaaagaacttaaaaacacgtgcaaagccgtgctg
gcgtgtgtgggagtctggataatgaccctgaccacgaccacccctctgctactgctctat
aaagacccagataaagactccactcccgccacctgcctcaagatttctgacatcatctat
ctaaaagctgtgaacgtgctgaacctcactcgactgacattttttttcttgattcctttg
ttcatcatgattgggtgctacttggtcattattcataatctccttcacggcaggacgtct
aagctgaaacccaaagtcaaggagaagtccataaggatcatcatcacgctgctggtgcag
gtgctcgtctgctttatgcccttccacatctgtttcgctttcctgatgctgggaacgggg
gagaacagttacaatccctggggagcctttaccaccttcctcatgaacctcagcacgtgt
ctggatgtgattctctactacatcgtttcaaaacaatttcaggctcgagtcattagtgtc
atgctataccgtaattaccttcgaagcatgcgcagaaaaagtttccgatctggtagtcta
cggtcactaagcaatataaacagtgaaatgttatga

DBGET integrated database retrieval system