KEGG   Homo sapiens (human): 284119
Entry
284119            CDS       T01001                                 
Symbol
CAVIN1, CAVIN, CGL4, FKSG13, PTRF, cavin-1
Name
(RefSeq) caveolae associated protein 1
  KO
K19387  polymerase I and transcript release factor
Organism
hsa  Homo sapiens (human)
Disease
H00419  Congenital generalized lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    284119 (CAVIN1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    Transcription termination factors
     284119 (CAVIN1)
SSDB
Motif
Pfam: PTRF_SDPR DUF1664 Glyco_hydro_4C
Other DBs
NCBI-GeneID: 284119
NCBI-ProteinID: NP_036364
OMIM: 603198
HGNC: 9688
Ensembl: ENSG00000177469
Pharos: Q6NZI2(Tbio)
UniProt: Q6NZI2
Position
17:complement(42402449..42423256)
AA seq 390 aa
MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDK
IIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVN
VKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPE
KEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEK
MEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKS
FTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGD
LRRGSSPDVHALLEITEESDAVLVDKSDSD
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaggaccccacgctctatattgtcgagcggccgcttcccgggtaccccgacgccgag
gccccggagccttcctccgctggggctcaggcagcggaggagccgtcgggggccggctca
gaagagctgatcaagtcggaccaggtgaacggcgtgctggtgctgagcctcctggacaaa
atcatcggggccgtagaccagatccagctgactcaagcacagctggaggagcggcaggcg
gagatggagggcgcagtgcagagcatccagggcgagctgagcaagctgggcaaggcgcac
gccaccacgagcaatacggtgagcaagctgctggagaaggtgcgcaaggtcagcgtcaac
gtgaagaccgtgcgcggcagcctggagcgccaggcggggcagatcaagaagctggaggtc
aacgaggccgagctgctgcggcgccgcaactttaaagtcatgatctaccaggatgaagtg
aagctgccggccaaactgagcatcagcaaatcgctgaaagagtcggaggcgctgccagag
aaggagggcgaggagctgggcgagggcgagcggcccgaggaggacgcagcggcgctggag
ctttcgtcggacgaggcggtggaggttgaggaggttattgaggagtcccgcgcagagcgt
atcaagcgcagcggcctgcggcgcgtggacgacttcaagaaggccttctccaaggagaag
atggagaagaccaaggtgcgtacccgcgagaacctggagaagacgcgcctcaagaccaag
gaaaacctggagaagacgcggcacaccctggagaagcgcatgaacaagctgggcacgcgc
ctggtgcccgccgagcggcgcgagaaactgaagacgtcgcgggacaagttgcgcaaatcc
ttcacgcccgaccacgtggtgtacgcgcgctccaagaccgcggtctacaaggtgccaccc
ttcaccttccacgtcaagaagatccgcgagggccaggtggaagtgctcaaggccaccgag
atggtggaggtgggcgccgacgacgacgagggcggcgcggagcgcggggaggccggcgac
ctgcggcgcgggagcagccccgacgtgcacgcgctgctggagatcaccgaggagtcggac
gccgtgctggtggacaagagcgacagcgactga

DBGET integrated database retrieval system