KEGG   Homo sapiens (human): 284129Help
Entry
284129            CDS       T01001                                 

Gene name
SLC26A11
Definition
(RefSeq) solute carrier family 26 member 11
  KO
K14708  solute carrier family 26 (sodium-independent sulfate anion transporter), member 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    284129 (SLC26A11)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   284129 (SLC26A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2
Motif
Other DBs
NCBI-GeneID: 284129
NCBI-ProteinID: NP_001159819
OMIM: 610117
HGNC: 14471
Ensembl: ENSG00000181045
Vega: OTTHUMG00000133419
Pharos: Q86WA9(Tdark)
UniProt: Q86WA9
Position
17q25.3
AA seq 606 aa AA seqDB search
MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP
RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV
WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT
EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV
LVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ
KQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
VALLKA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcggtgacggcgctgggtcaggccaggtcctctggccccgggatggccccg
agcgcctgctgctgctcccctgcggccctgcagaggaggctgcccatcctggcgtggctg
cccagctactccctgcagtggctgaagatggatttcgtcgccggcctctcagttggcctc
actgccattccccaggcgctggcctatgctgaagtggctggactcccgccccagtatggc
ctctactctgccttcatgggctgcttcgtgtatttcttcctgggcacctcccgggatgtg
actctgggccccaccgccattatgtccctcctggtctccttctacaccttccatgagccc
gcctacgctgtgctgctggccttcctgtccggctgcatccagctggccatgggggtcctg
cgtttggggttcctgctggacttcatttcctaccccgtcattaaaggcttcacctctgct
gctgccgtcaccatcggctttggacagatcaagaacctgctgggactacagaacatcccc
aggccgttcttcctgcaggtgtaccacaccttcctcaggattgcagagaccagggtaggt
gacgccgtcctggggctggtctgcatgctgctgctgctggtgctgaagctgatgcgggac
cacgtgcctcccgtccaccccgagatgccccctggtgtgcggctcagccgtgggctggtc
tgggctgccacgacagctcgcaacgccctggtggtctccttcgcagccctggttgcgtac
tccttcgaggtgactggataccagcctttcatcctaacaggggagacagctgaggggctc
cctccagtccggatcccgcccttctcagtgaccacagccaacgggacgatctccttcacc
gagatggtgcaggacatgggagccgggctggccgtggtgcccctgatgggcctcctggag
agcattgcggtggccaaagccttcgcatctcagaataattaccgcatcgatgccaaccag
gagctgctggccatcggtctcaccaacatgttgggctccctcgtctcctcctacccggtc
acaggcagctttggacggacagccgtgaacgctcagtcgggggtgtgcaccccggcgggg
ggcctggtgacgggagtgctggtgctgctgtctctggactacctgacctcactgttctac
tacatccccaagtctgccctggctgccgtcatcatcatggccgtggccccgctgttcgac
accaagatcttcaggacgctctggcgtgttaagaggctggacctgctgcccctgtgcgtg
accttcctgctgtgcttctgggaggtgcagtacggcatcctggccggggccctggtgtct
ctgctcatgctcctgcactctgcagccaggcctgagaccaaggtgtcagaggggccggtt
ctggtcctgcagccggccagcggcctgtccttccctgccatggaggctctgcgggaggag
atcctaagccgggccctggaagtgtccccgccacgctgcctggtcctggagtgcacccat
gtctgcagcatcgactacactgtggtgctgggactcggcgagctcctccaggacttccag
aagcagggcgtcgccctggcctttgtgggcctgcaggtccccgttctccgtgtcctgctg
tccgctgacctgaaggggttccagtacttctctaccctggaagaagcagagaagcacctg
aggcaggagccagggacccagccctacaacatcagagaagactccattctggaccaaaag
gttgccctgctcaaggcataa

DBGET integrated database retrieval system