KEGG   Homo sapiens (human): 284161
Entry
284161            CDS       T01001                                 

Gene name
GDPD1, GDE4
Definition
(RefSeq) glycerophosphodiester phosphodiesterase domain containing 1
  KO
K22387  lysophospholipase D [EC:3.1.4.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    284161 (GDPD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     284161 (GDPD1)
SSDB
Motif
Pfam: GDPD GDPD_2 PI-PLC-X
Other DBs
NCBI-GeneID: 284161
NCBI-ProteinID: NP_872375
OMIM: 616317
HGNC: 20883
Ensembl: ENSG00000153982
Vega: OTTHUMG00000179376
Pharos: Q8N9F7(Tbio)
UniProt: Q8N9F7
Position
17q22
AA seq 314 aa
MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAF
QHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF
QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGN
ANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKE
PHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTD
YPTKLRDFLHNFSA
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtcgtccactgcggctttttaccttctctctacgctaggaggatacttggtgacctca
ttcttgttgcttaaatacccgaccttgctgcaccagagaaagaagcagcgattcctcagt
aaacacatctctcaccgcggaggtgctggagaaaatttggagaatacaatggcagccttt
cagcatgcggttaaaatcggaactgatatgctagaattggactgccatatcacaaaagat
gaacaagttgtagtgtcacatgatgagaatctaaagagagcaactggggtcaatgtaaac
atctctgatctcaaatactgtgagctcccaccttaccttggcaaactggatgtctcattt
caaagagcatgccagtgtgaaggaaaagataaccgaattccattactgaaggaagttttt
gaggcctttcctaacactcccattaacatcgatatcaaagtcaacaacaatgtgctgatt
aagaaggtttcagagttggtgaagcggtataatcgagaacacttaacagtgtggggtaat
gccaattatgaaattgtagaaaagtgctacaaagagaattcagatattcctatactcttc
agtctacaacgtgtcctgctcattcttggccttttcttcactggcctcttgccctttgtg
cccattcgagaacagttttttgaaatcccaatgccttctattatactgaagctaaaagaa
ccacacaccatgtccagaagtcaaaagtttctcatctggctttctgatctcttactaatg
aggaaagctttgtttgaccacctaactgctcgaggcattcaagtgtatatttgggtatta
aatgaagaacaagaatacaaaagagcttttgatttgggagcaactggggtgatgacagac
tatccaacaaagcttagggattttttacataacttttcagcatag

KEGG   Homo sapiens (human): 5168
Entry
5168              CDS       T01001                                 

Gene name
ENPP2, ATX, ATX-X, AUTOTAXIN, LysoPLD, NPP2, PD-IALPHA, PDNP2
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 2
  KO
K01122  ectonucleotide pyrophosphatase/phosphodiesterase family member 2 [EC:3.1.4.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Drug target
Ziritaxestat: D11844
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5168 (ENPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     5168 (ENPP2)
SSDB
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase
Other DBs
NCBI-GeneID: 5168
NCBI-ProteinID: NP_001035181
OMIM: 601060
HGNC: 3357
Ensembl: ENSG00000136960
Vega: OTTHUMG00000164995
Pharos: Q13822(Tchem)
UniProt: Q13822
Structure
PDB: 

Position
8q24.12
AA seq 863 aa
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggcaaggaggagctcgttccagtcgtgtcagataatatccctgttcacttttgccgtt
ggagtcaatatctgcttaggattcactgcacatcgaattaagagagcagaaggatgggag
gaaggtcctcctacagtgctatcagactccccctggaccaacatctccggatcttgcaag
ggcaggtgctttgaacttcaagaggctggacctcctgattgtcgctgtgacaacttgtgt
aagagctataccagttgctgccatgactttgatgagctgtgtttgaagacagcccgtggc
tgggagtgtactaaggacagatgtggagaagtcagaaatgaagaaaatgcctgtcactgc
tcagaggactgcttggccaggggagactgctgtaccaattaccaagtggtttgcaaagga
gagtcgcattgggttgatgatgactgtgaggaaataaaggccgcagaatgccctgcaggg
tttgttcgccctccattaatcatcttctccgtggatggcttccgtgcatcatacatgaag
aaaggcagcaaagtcatgcctaatattgaaaaactaaggtcttgtggcacacactctccc
tacatgaggccggtgtacccaactaaaacctttcctaacttatacactttggccactggg
ctatatccagaatcacatggaattgttggcaattcaatgtatgatcctgtatttgatgcc
acttttcatctgcgagggcgagagaaatttaatcatagatggtggggaggtcaaccgcta
tggattacagccaccaagcaaggggtgaaagctggaacattcttttggtctgttgtcatc
cctcacgagcggagaatattaaccatattgcagtggctcaccctgccagatcatgagagg
ccttcggtctatgccttctattctgagcaacctgatttctctggacacaaatatggccct
ttcggccctgagatgacaaatcctctgagggaaatcgacaaaattgtggggcaattaatg
gatggactgaaacaactaaaactgcatcggtgtgtcaacgtcatctttgtcggagaccat
ggaatggaagatgtcacatgtgatagaactgagttcttgagtaattacctaactaatgtg
gatgatattactttagtgcctggaactctaggaagaattcgatccaaatttagcaacaat
gctaaatatgaccccaaagccattattgccaatctcacgtgtaaaaaaccagatcagcac
tttaagccttacttgaaacagcaccttcccaaacgtttgcactatgccaacaacagaaga
attgaggatatccatttattggtggaacgcagatggcatgttgcaaggaaacctttggat
gtttataagaaaccatcaggaaaatgctttttccagggagaccacggatttgataacaag
gtcaacagcatgcagactgtttttgtaggttatggctcaacatttaagtacaagactaaa
gtgcctccatttgaaaacattgaactttacaatgttatgtgtgatctcctgggattgaag
ccagctcctaataatgggacccatggaagtttgaatcatctcctgcgcactaataccttc
aggccaaccatgccagaggaagttaccagacccaattatccagggattatgtaccttcag
tctgattttgacctgggctgcacttgtgatgataaggtagagccaaagaacaagttggat
gaactcaacaaacggcttcatacaaaagggtctacagaagagagacacctcctctatggg
cgacctgcagtgctttatcggactagatatgatatcttatatcacactgactttgaaagt
ggttatagtgaaatattcctaatgccactctggacatcatatactgtttccaaacaggct
gaggtttccagcgttcctgaccatctgaccagttgcgtccggcctgatgtccgtgtttct
ccgagtttcagtcagaactgtttggcctacaaaaatgataagcagatgtcctacggattc
ctctttcctccttatctgagctcttcaccagaggctaaatatgatgcattccttgtaacc
aatatggttccaatgtatcctgctttcaaacgggtctggaattatttccaaagggtattg
gtgaagaaatatgcttcggaaagaaatggagttaacgtgataagtggaccaatcttcgac
tatgactatgatggcttacatgacacagaagacaaaataaaacagtacgtggaaggcagt
tccattcctgttccaactcactactacagcatcatcaccagctgtctggatttcactcag
cctgccgacaagtgtgacggccctctctctgtgtcctccttcatcctgcctcaccggcct
gacaacgaggagagctgcaatagctcagaggacgaatcaaaatgggtagaagaactcatg
aagatgcacacagctagggtgcgtgacattgaacatctcaccagcctggacttcttccga
aagaccagccgcagctacccagaaatcctgacactcaagacatacctgcatacatatgag
agcgagatttaa

KEGG   Homo sapiens (human): 79153
Entry
79153             CDS       T01001                                 

Gene name
GDPD3, GDE7
Definition
(RefSeq) glycerophosphodiester phosphodiesterase domain containing 3
  KO
K22387  lysophospholipase D [EC:3.1.4.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    79153 (GDPD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     79153 (GDPD3)
SSDB
Motif
Pfam: GDPD GDPD_2
Other DBs
NCBI-GeneID: 79153
NCBI-ProteinID: NP_077283
OMIM: 616318
HGNC: 28638
Ensembl: ENSG00000102886
Vega: OTTHUMG00000132106
Pharos: Q7L5L3(Tdark)
UniProt: Q7L5L3
Position
16p11.2
AA seq 318 aa
MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAME
NSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFS
PGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASE
KSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFP
FSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDY
PTALRHYLDNHGPAARTS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagccttttgctgtactatgccctccctgccctgggcagctatgccatgctctccatc
ttcttcctgcgccggcctcatctgctgcacacgcccagggctcccaccttccgcatccgc
ctgggggcccaccgaggaggatctggagagctgctggagaacaccatggaggccatggag
aactccatggcccagcgctcggacctcctggagctcgactgtcagctgacacgggacaga
gtggtggtggtgtcacatgatgagaacctgtgccgccagtcgggcctaaacagggatgtg
ggcagcctggacttcgaggacctgcccctctacaaggagaagctggaggtttacttctct
ccaggccactttgctcacgggtcagaccggcgcatggttcgtctggaggacctgttccag
aggtttccaaggacacccatgagcgtagagatcaaagggaagaacgaagagctcatccgt
gagatagcaggcttggtgagacgctatgaccgtaatgaaatcaccatctgggcctcggag
aagagctcggtcatgaagaaatgcaaggctgccaaccccgagatgcccctgtccttcaca
ataagccgaggattctgggtgctgctttcctactacctggggctgctgcccttcatccca
atccctgagaagttcttcttctgcttcctgcccaacatcatcaacaggacctatttccca
ttttcctgctcttgcctgaaccagttattggctgtggtttcgaaatggctgatcatgagg
aagagtctgatccgacacttggaggagcgaggggtgcaggtggtcttttggtgccttaat
gaagagtcggattttgaagcagccttcagcgtgggagccactggcgtcataacggattat
cccacagccctgcggcactacctggacaaccatggaccagctgcccggacctcctaa

DBGET integrated database retrieval system