KEGG   Homo sapiens (human): 284217Help
Entry
284217            CDS       T01001                                 

Gene name
LAMA1, LAMA, PTBHS, S-LAM-alpha
Definition
(RefSeq) laminin subunit alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    284217 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    284217 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    284217 (LAMA1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    284217 (LAMA1)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    284217 (LAMA1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    284217 (LAMA1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    284217 (LAMA1)
   05145 Toxoplasmosis
    284217 (LAMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF1080
Motif
Other DBs
NCBI-GeneID: 284217
NCBI-ProteinID: NP_005550
OMIM: 150320
HGNC: 6481
Ensembl: ENSG00000101680
Vega: OTTHUMG00000133478
Pharos: P25391(Tbio)
UniProt: P25391
Position
18p11.31
AA seq 3075 aa AA seqDB search
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES
NT seq 9228 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggggcgtgctcctggtcttgctgctgtgtgtcgccgcgcagtgccggcagaga
ggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagcaccaatgccacc
tgtggcgagaaggggccggagatgttctgcaaacttgtggagcatgtgccaggtcggccc
gtccgaaacccacagtgccggatctgtgatggcaacagcgcaaaccccagagaacgccat
ccaatatcacatgccatagatggcaccaataactggtggcaaagtcccagcattcagaat
gggagagaatatcactgggtcacaatcactctggacttaagacaggtctttcaagttgca
tatgtcatcattaaagctgccaatgcccctcgacctggaaactggattttggagcgttct
ctggatggcaccacgttcagcccctggcagtattatgcagtcagcgactcagagtgtttg
tctcgttacaatataactccaagacgagggccacccacctacagggctgatgatgaagtg
atctgcacctcctattattccagattggtgccacttgagcatggagagattcatacatca
ctcatcaatggcagaccaagcgctgacgatctttcacccaagttgttggaattcacttct
gcacgatatattcgccttcgcttgcaacgcattagaacgctcaatgcagatctcatgacc
cttagccaccgggaacctaaagaactggatcctattgttaccagacgctattattattca
ataaaggacatttctgttggaggcatgtgtatctgctatggccatgctagtagctgccca
tgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatacttgcggggagagc
tgtaacaggtgctgtcctgggtaccatcagcagccctggaggccgggaaccgtgtcctcc
ggcaatacatgtgaagcatgtaattgtcacaataaagccaaagactgttactatgatgaa
agtgttgcaaagcagaagaaaagtttgaatactgctggacagttcagaggaggaggggtt
tgcataaattgcttgcagaacaccatgggaatcaactgtgaaacctgtattgatggatat
tatagaccacacaaagtgtctccttatgaggatgagccttgccgcccctgtaattgtgac
cctgtggggtccctcagttctgtctgtattaaggatgacctccattctgacttacacaat
gggaagcagccaggtcagtgcccatgtaaggaaggttatacaggagaaaaatgtgatcgc
tgccaacttggctataaggattacccgacctgtgtctcctgtgggtgcaacccagtgggc
agtgccagtgatgagccctgcacagggccctgtgtttgtaaggaaaacgttgaggggaag
gcctgtgatcgctgcaagccaggattctataacttgaaggaaaaaaacccccggggctgc
tccgagtgcttctgctttggcgtttctgatgtctgcagcagcctctcttggcctgttggt
caggtaaacagtatgtccgggtggctggtcaccgacttgatcagtcccaggaagatcccg
tctcagcaagatgcactaggcgggcgccatcaggtcagcatcaacaacaccgcggtcatg
cagagactggctcccaagtactactgggcagcccccgaggcctaccttggaaataagctg
actgcgtttggcggattcctgaaatacacggtgtcctacgatattccggtagagacggta
gacagtaacctcatgtcgcatgctgacgtcatcattaagggaaacggactcactttaagc
acacaggctgagggtctgtcattgcagccttatgaagagtacctaaacgtggttagactt
gtgcctgaaaacttccaagattttcacagcaaaaggcagattgatcgtgaccagctgatg
actgtccttgccaatgtgacacatcttttgatcagagccaactacaattctgcaaaaatg
gctctttacaggttggagtccgtctctctggacatagccagctctaatgccatcgacctg
gtggtggccgctgatgtggagcactgtgaatgtccgcaaggctacacagggacctcctgt
gagtcgtgcctctctggctattaccgcgtggatggaatactctttggaggaatttgtcaa
ccctgtgaatgccacggccatgcagctgagtgtaatgttcacggcgtttgcattgcgtgt
gcgcacaacaccaccggcgtccactgtgagcagtgcttgcccggcttctacggggagcct
tcccgagggacacctggggactgccagccctgcgcctgccctctcaccatagcctccaac
aatttcagccccacctgccacctcaatgatggagatgaagtggtctgtgactggtgtgcc
ccgggctactcaggagcttggtgtgagagatgtgcagatggttactatggaaacccaaca
gtgcctggcgaatcttgtgttccctgtgactgcagcggcaacgtggacccctcggaggct
ggtcactgtgactcagtcaccggggagtgcctgaagtgcctggggaacacagatggcgcc
cactgtgaaaggtgtgctgacgggttctatggggacgctgtgacagccaagaactgccgc
gcctgtgaatgccatgtgaaaggctcccattctgccgtgtgccatcttgagaccgggctc
tgtgactgcaaaccaaacgtgactggacagcagtgtgaccagtgcttgcatggctattat
gggctggactcaggccatggctgccggccctgcaactgcagcgtggcaggctccgtgtca
gatggctgcacggatgaaggccagtgtcactgtgtcccaggtgtggcagggaaaaggtgt
gacaggtgtgcccatggcttctacgcctaccaggatggtagctgtacaccctgtgactgc
ccacacactcagaatacctgcgacccagaaactggagagtgtgtctgcccccctcacaca
cagggtgtgaagtgtgaagaatgtgaggatgggcactggggctacgatgcggaggtgggg
tgccaggcctgcaattgcagtctcgtggggtcgactcatcatcggtgcgatgtggtcacc
ggccattgccagtgcaagtcaaaatttggtggccgggcctgcgatcagtgttccttgggt
tacagagactttcccgactgtgttccctgtgactgtgacctgagggggacgtcgggggac
gcctgcaacctggagcagggtctctgcggctgtgtggaggaaaccggggcctgcccttgc
aaggaaaatgtctttggtcctcagtgcaacgaatgtcgagagggcaccttcgctctccgc
gcagacaaccccctgggctgcagcccgtgcttctgctccgggctgtcccacctctgctca
gagctggaggactacgtgaggaccccagtaacgctgggctccgatcagcctcttctgcgt
gtggtttctcagagtaacttgaggggcacgaccgagggggtttactaccaggcccccgac
ttcctgctggatgccgccaccgtccggcagcacatccgtgcagagccgttttactggcgg
ctgccgcagcagttccaaggagaccagctcatggcctatggtggcaaactgaagtacagc
gtggccttctattctttggatggcgtcggcacctccaattttgagcctcaagttctcatc
aaaggtggtcggatcagaaagcaagtcatttacatggatgcaccagccccagagaatgga
gtgagacaggaacaagaagtagcaatgagagagaatttttggaaatattttaactctgtt
tctgaaaaacctgtcacgcgagaggattttatgtctgtcctcagcgatattgagtacatc
ctcatcaaggcatcgtatggtcaaggattacagcagagcagaatctcagacatttcaatg
gaggttggcagaaaggctgaaaagctgcacccagaagaagaggttgcatctcttttagag
aattgtgtctgtcctcctggcactgtgggattctcatgtcaggactgcgcccctgggtac
cacagagggaagctcccagcagggagtgacaggggaccacgccctctggttgctccttgt
gttccctgcagttgcaacaaccacagtgacacctgtgaccccaacaccgggaagtgtctg
aactgtggcgataacacagcaggtgaccattgtgatgtgtgtacttctggctactacggg
aaggtgactggctcagcaagtgactgtgctctgtgtgcctgtcctcacagccctcctgcc
agttttagtcccacttgtgtcttggaaggggaccacgatttccgttgtgacgcctgtctc
ctgggctatgaaggaaaacactgtgaaaggtgctcctcaagctattatgggaaccctcaa
acaccaggtggcagttgccagaagtgtgactgcaacccgcacggctctgtccacggtgac
tgtgaccgcacatctgggcagtgcgtttgcaggctgggggcctcggggctccggtgcgat
gagtgtgaaccgaggcacattctgatggaaacagattgtgtttcctgtgatgatgagtgt
gtaggtgtgctgctgaatgacttggatgagattggtgatgccgttctttctctgaacctc
actggcattatccctgtcccatatggaattttgtcaaacctggaaaatacaactaaatat
ctccaggaatctttattaaaagaaaatatgcaaaaggacctgggaaaaattaagcttgaa
ggtgttgcagaagaaacggacaacctgcaaaagaagctcactaggatgttagcgagtacc
caaaaggtgaatagggcaactgagagaatcttcaaggagagtcaagacctggccatagcc
attgagaggctgcagatgagcatcacagaaattatggaaaagacaactttaaatcagact
ttggatgaagatttcctactacccaattctactcttcagaacatgcaacagaatggtaca
tctttgctagaaatcatgcagataagagacttcacacagttgcaccaaaatgccaccctt
gaactcaaggctgctgaagatttattgtcacaaattcaggaaaattaccagaagccgctg
gaagaattggaggtattgaaagaagcagcaagccacgtcctttcaaagcacaacaatgaa
ctaaaggcggctgaggcgctcgtgagggaagctgaggcaaagatgcaggaaagcaaccac
ctgctgctcatggtcaatgctaatctgagagaattcagtgataaaaagctgcatgttcaa
gaagaacaaaatctgacctcagagctcattgtccaaggaagaggattgatagatgctgct
gctgcacaaacagatgctgtacaagatgctctagagcacttagaggatcaccaggataag
ctacttttatggtctgccaaaatcaggcaccacatagatgacctggtcatgcacatgtcc
caaaggaacgcagtcgacctggtctacagagctgaggaccatgccgctgagttccagaga
ctagcagatgttctgtacagtggccttgaaaacatcagaaatgtgtccctgaatgccacc
agtgcagcctatgtccattacaacatccagagcctgattgaagaatcggaggaactggcc
agagatgctcacaggactgtgactgagacgagcctgctctcagaatcccttgtttctaac
gggaaagcggccgtgcagcgcagctccagatttctaaaagaaggcaacaacctcagcagg
aagcttccaggtattgcattggaactgagtgaattgagaaataagacaaacagatttcaa
gagaatgctgttgaaattaccaggcaaaccaatgaatcactcttgatacttagagcaatt
cctaaaggtataagagacaagggagccaaaaccaaagagctggccacgtctgcaagccag
agcgcggtgagcacgctgagggacgtggcggggctgagccaggagctgctgaacacatct
gccagcctgtccagggtcaacaccacattacgagagacacaccagcttctgcaggactcc
accatggccactctgttggctggaagaaaagtcaaagacgtggaaattcaagccaacctt
ttgtttgatcggttgaagcctttgaagatgttagaggagaatctgagcagaaacctatca
gaaattaaactgttgatcagccaggcccgcaaacaagcagcttctattaaagtcgccgtg
tctgcagacagagattgcatccgggcctaccagcctcagatttcctctaccaactacaat
accttaacactaaatgttaagacacaggaacccgataatcttctcttctacctcggtagc
agcaccgcttctgatttccttgcagtggagatgcggcgagggagagtggccttcctgtgg
gacctgggctccgggtccacacgcttggagtttccagactttcccattgatgacaacaga
tggcacagtatccatgtagccagatttggaaacattggttcactgagtgtaaaggaaatg
agctcaaatcaaaagtcaccaacaaaaacaagtaaatcccctgggacagctaatgttctg
gatgtaaacaattcaacactcatgtttgttggaggtcttggaggacaaatcaagaaatct
cctgctgtgaaggttactcattttaaaggctgcttgggggaggccttcctgaatggaaaa
tccataggcctatggaactatattgaaagggaaggcaagtgccgtgggtgcttcggaagc
tcccagaatgaagacccttccttccattttgacgggagtgggtactctgtcgtggagaag
tcacttccggctaccgtgacccagataatcatgctttttaataccttttcacctaatgga
cttcttctctacctgggttcatacggcacaaaagactttttatccatcgagctgtttcgt
ggcagagtgaaggttatgactgacctgggttcaggacccattacccttttgacagacaga
cgttataacaatggaacctggtacaaaattgccttccagcgaaaccggaagcaaggagtg
ctagcagttatcgatgcctataacaccagtaataaagaaaccaagcagggcgagactccg
ggagcatcttctgacctcaaccgcctagacaaggacccgatttatgtgggtggattacca
aggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtgggctgcatcaagaac
ctggaaatatccagatcaacctttgacttactcagaaattcctatggagtgagaaaaggc
tgtttactggagcccatccggagtgttagcttcctgaaaggcggctacattgaattgcca
cccaaatctttgtcaccagaatcagaatggctggtaacatttgccaccacgaacagcagt
ggcatcatcctggctgccctcggcggggatgtggagaagcggggtgatcgtgaggaagca
cacgtgcccttcttttccgtcatgctgatcggaggcaacattgaggtacatgtcaatcct
ggggatgggacaggcctgagaaaagctctcctgcacgctcccacgggtacctgcagtgat
ggacaagcgcattccatctccttggtcaggaatcggagaattatcactgtccaattggat
gagaacaatcctgtggaaatgaagttgggcacattagtagaaagcaggacgataaatgtg
tccaatctgtacgtcgggggaattccagagggagaggggacgtcactgctcacaatgaga
agatcgttccatggctgtatcaaaaacctgatcttcaatttggaacttttggatttcaac
agtgcagttggccatgagcaagtcgacctggacacctgctggctgtcagaaaggcctaag
ctggctcccgatgcagaggacagcaagctcttgccagagccccgggcttttccagaacag
tgtgtggtggatgcagctctggagtacgttcccggcgctcaccagtttggtctcacacaa
aacagccatttcatcttgccttttaatcagtcggctgtcagaaagaagctctcggttgag
ctaagcatccgcacgttcgcctccagcggcctgatttactacatggctcatcagaaccaa
gcagactacgctgtgctccagctgcacgggggccgcctccacttcatgtttgaccttggc
aaaggcagaacaaaggtctctcaccctgcactgctcagtgatggcaagtggcacacggtc
aagacagactatgttaaaagaaaaggcttcataactgtcgacggccgagagtctcccatg
gtgactgtggtgggagatggaaccatgctggatgtggagggtttgttctacctaggaggc
ctgccctcccagtaccaggccaggaaaattggaaatatcacccacagcatccctgcctgc
attggggatgtgacggttaacagcaaacagctggacaaggacagcccggtgtctgccttc
acggtgaacaggtgctacgcagtggcccaggaaggaacatactttgacggaagcggatat
gcagctcttgtcaaagagggctacaaagtccagtcagatgtgaacatcacactggagttt
cgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaagtggatgccatt
ggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggtgctggcaggata
acagctgcatatgagcccaaaaccgccactgtgctctgtgatggaaaatggcacactctt
caagctaacaaaagcaaacaccgtatcactctgattgttgacgggaacgcagttggcgct
gaaagtccacacacccagtctacctcagtggacaccaacaatcccatttatgttggtggc
tatcctgctggtgtgaagcaaaaatgcctgcgcagccagacctcgttccgcgggtgtttg
aggaagctagctctgattaagagcccgcaggtgcagtcctttgacttcagcagagcgttc
gaactgcacggagttttccttcattcctgtcctgggaccgagtcctga

DBGET integrated database retrieval system