KEGG   Homo sapiens (human): 284217
Entry
284217            CDS       T01001                                 

Gene name
LAMA1, LAMA, PTBHS, S-LAM-alpha
Definition
(RefSeq) laminin subunit alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    284217 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    284217 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    284217 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    284217 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    284217 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    284217 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    284217 (LAMA1)
   05414 Dilated cardiomyopathy
    284217 (LAMA1)
   05416 Viral myocarditis
    284217 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    284217 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    284217 (LAMA1)
   05145 Toxoplasmosis
    284217 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 DUF1080
Other DBs
NCBI-GeneID: 284217
NCBI-ProteinID: NP_005550
OMIM: 150320
HGNC: 6481
Ensembl: ENSG00000101680
Vega: OTTHUMG00000133478
Pharos: P25391(Tbio)
UniProt: P25391
Position
18p11.31
AA seq 3075 aa
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES
NT seq 9228 nt   +upstreamnt  +downstreamnt
atgcgcgggggcgtgctcctggtcttgctgctgtgtgtcgccgcgcagtgccggcagaga
ggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagcaccaatgccacc
tgtggcgagaaggggccggagatgttctgcaaacttgtggagcatgtgccaggtcggccc
gtccgaaacccacagtgccggatctgtgatggcaacagcgcaaaccccagagaacgccat
ccaatatcacatgccatagatggcaccaataactggtggcaaagtcccagcattcagaat
gggagagaatatcactgggtcacaatcactctggacttaagacaggtctttcaagttgca
tatgtcatcattaaagctgccaatgcccctcgacctggaaactggattttggagcgttct
ctggatggcaccacgttcagcccctggcagtattatgcagtcagcgactcagagtgtttg
tctcgttacaatataactccaagacgagggccacccacctacagggctgatgatgaagtg
atctgcacctcctattattccagattggtgccacttgagcatggagagattcatacatca
ctcatcaatggcagaccaagcgctgacgatctttcacccaagttgttggaattcacttct
gcacgatatattcgccttcgcttgcaacgcattagaacgctcaatgcagatctcatgacc
cttagccaccgggaacctaaagaactggatcctattgttaccagacgctattattattca
ataaaggacatttctgttggaggcatgtgtatctgctatggccatgctagtagctgccca
tgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatacttgcggggagagc
tgtaacaggtgctgtcctgggtaccatcagcagccctggaggccgggaaccgtgtcctcc
ggcaatacatgtgaagcatgtaattgtcacaataaagccaaagactgttactatgatgaa
agtgttgcaaagcagaagaaaagtttgaatactgctggacagttcagaggaggaggggtt
tgcataaattgcttgcagaacaccatgggaatcaactgtgaaacctgtattgatggatat
tatagaccacacaaagtgtctccttatgaggatgagccttgccgcccctgtaattgtgac
cctgtggggtccctcagttctgtctgtattaaggatgacctccattctgacttacacaat
gggaagcagccaggtcagtgcccatgtaaggaaggttatacaggagaaaaatgtgatcgc
tgccaacttggctataaggattacccgacctgtgtctcctgtgggtgcaacccagtgggc
agtgccagtgatgagccctgcacagggccctgtgtttgtaaggaaaacgttgaggggaag
gcctgtgatcgctgcaagccaggattctataacttgaaggaaaaaaacccccggggctgc
tccgagtgcttctgctttggcgtttctgatgtctgcagcagcctctcttggcctgttggt
caggtaaacagtatgtccgggtggctggtcaccgacttgatcagtcccaggaagatcccg
tctcagcaagatgcactaggcgggcgccatcaggtcagcatcaacaacaccgcggtcatg
cagagactggctcccaagtactactgggcagcccccgaggcctaccttggaaataagctg
actgcgtttggcggattcctgaaatacacggtgtcctacgatattccggtagagacggta
gacagtaacctcatgtcgcatgctgacgtcatcattaagggaaacggactcactttaagc
acacaggctgagggtctgtcattgcagccttatgaagagtacctaaacgtggttagactt
gtgcctgaaaacttccaagattttcacagcaaaaggcagattgatcgtgaccagctgatg
actgtccttgccaatgtgacacatcttttgatcagagccaactacaattctgcaaaaatg
gctctttacaggttggagtccgtctctctggacatagccagctctaatgccatcgacctg
gtggtggccgctgatgtggagcactgtgaatgtccgcaaggctacacagggacctcctgt
gagtcgtgcctctctggctattaccgcgtggatggaatactctttggaggaatttgtcaa
ccctgtgaatgccacggccatgcagctgagtgtaatgttcacggcgtttgcattgcgtgt
gcgcacaacaccaccggcgtccactgtgagcagtgcttgcccggcttctacggggagcct
tcccgagggacacctggggactgccagccctgcgcctgccctctcaccatagcctccaac
aatttcagccccacctgccacctcaatgatggagatgaagtggtctgtgactggtgtgcc
ccgggctactcaggagcttggtgtgagagatgtgcagatggttactatggaaacccaaca
gtgcctggcgaatcttgtgttccctgtgactgcagcggcaacgtggacccctcggaggct
ggtcactgtgactcagtcaccggggagtgcctgaagtgcctggggaacacagatggcgcc
cactgtgaaaggtgtgctgacgggttctatggggacgctgtgacagccaagaactgccgc
gcctgtgaatgccatgtgaaaggctcccattctgccgtgtgccatcttgagaccgggctc
tgtgactgcaaaccaaacgtgactggacagcagtgtgaccagtgcttgcatggctattat
gggctggactcaggccatggctgccggccctgcaactgcagcgtggcaggctccgtgtca
gatggctgcacggatgaaggccagtgtcactgtgtcccaggtgtggcagggaaaaggtgt
gacaggtgtgcccatggcttctacgcctaccaggatggtagctgtacaccctgtgactgc
ccacacactcagaatacctgcgacccagaaactggagagtgtgtctgcccccctcacaca
cagggtgtgaagtgtgaagaatgtgaggatgggcactggggctacgatgcggaggtgggg
tgccaggcctgcaattgcagtctcgtggggtcgactcatcatcggtgcgatgtggtcacc
ggccattgccagtgcaagtcaaaatttggtggccgggcctgcgatcagtgttccttgggt
tacagagactttcccgactgtgttccctgtgactgtgacctgagggggacgtcgggggac
gcctgcaacctggagcagggtctctgcggctgtgtggaggaaaccggggcctgcccttgc
aaggaaaatgtctttggtcctcagtgcaacgaatgtcgagagggcaccttcgctctccgc
gcagacaaccccctgggctgcagcccgtgcttctgctccgggctgtcccacctctgctca
gagctggaggactacgtgaggaccccagtaacgctgggctccgatcagcctcttctgcgt
gtggtttctcagagtaacttgaggggcacgaccgagggggtttactaccaggcccccgac
ttcctgctggatgccgccaccgtccggcagcacatccgtgcagagccgttttactggcgg
ctgccgcagcagttccaaggagaccagctcatggcctatggtggcaaactgaagtacagc
gtggccttctattctttggatggcgtcggcacctccaattttgagcctcaagttctcatc
aaaggtggtcggatcagaaagcaagtcatttacatggatgcaccagccccagagaatgga
gtgagacaggaacaagaagtagcaatgagagagaatttttggaaatattttaactctgtt
tctgaaaaacctgtcacgcgagaggattttatgtctgtcctcagcgatattgagtacatc
ctcatcaaggcatcgtatggtcaaggattacagcagagcagaatctcagacatttcaatg
gaggttggcagaaaggctgaaaagctgcacccagaagaagaggttgcatctcttttagag
aattgtgtctgtcctcctggcactgtgggattctcatgtcaggactgcgcccctgggtac
cacagagggaagctcccagcagggagtgacaggggaccacgccctctggttgctccttgt
gttccctgcagttgcaacaaccacagtgacacctgtgaccccaacaccgggaagtgtctg
aactgtggcgataacacagcaggtgaccattgtgatgtgtgtacttctggctactacggg
aaggtgactggctcagcaagtgactgtgctctgtgtgcctgtcctcacagccctcctgcc
agttttagtcccacttgtgtcttggaaggggaccacgatttccgttgtgacgcctgtctc
ctgggctatgaaggaaaacactgtgaaaggtgctcctcaagctattatgggaaccctcaa
acaccaggtggcagttgccagaagtgtgactgcaacccgcacggctctgtccacggtgac
tgtgaccgcacatctgggcagtgcgtttgcaggctgggggcctcggggctccggtgcgat
gagtgtgaaccgaggcacattctgatggaaacagattgtgtttcctgtgatgatgagtgt
gtaggtgtgctgctgaatgacttggatgagattggtgatgccgttctttctctgaacctc
actggcattatccctgtcccatatggaattttgtcaaacctggaaaatacaactaaatat
ctccaggaatctttattaaaagaaaatatgcaaaaggacctgggaaaaattaagcttgaa
ggtgttgcagaagaaacggacaacctgcaaaagaagctcactaggatgttagcgagtacc
caaaaggtgaatagggcaactgagagaatcttcaaggagagtcaagacctggccatagcc
attgagaggctgcagatgagcatcacagaaattatggaaaagacaactttaaatcagact
ttggatgaagatttcctactacccaattctactcttcagaacatgcaacagaatggtaca
tctttgctagaaatcatgcagataagagacttcacacagttgcaccaaaatgccaccctt
gaactcaaggctgctgaagatttattgtcacaaattcaggaaaattaccagaagccgctg
gaagaattggaggtattgaaagaagcagcaagccacgtcctttcaaagcacaacaatgaa
ctaaaggcggctgaggcgctcgtgagggaagctgaggcaaagatgcaggaaagcaaccac
ctgctgctcatggtcaatgctaatctgagagaattcagtgataaaaagctgcatgttcaa
gaagaacaaaatctgacctcagagctcattgtccaaggaagaggattgatagatgctgct
gctgcacaaacagatgctgtacaagatgctctagagcacttagaggatcaccaggataag
ctacttttatggtctgccaaaatcaggcaccacatagatgacctggtcatgcacatgtcc
caaaggaacgcagtcgacctggtctacagagctgaggaccatgccgctgagttccagaga
ctagcagatgttctgtacagtggccttgaaaacatcagaaatgtgtccctgaatgccacc
agtgcagcctatgtccattacaacatccagagcctgattgaagaatcggaggaactggcc
agagatgctcacaggactgtgactgagacgagcctgctctcagaatcccttgtttctaac
gggaaagcggccgtgcagcgcagctccagatttctaaaagaaggcaacaacctcagcagg
aagcttccaggtattgcattggaactgagtgaattgagaaataagacaaacagatttcaa
gagaatgctgttgaaattaccaggcaaaccaatgaatcactcttgatacttagagcaatt
cctaaaggtataagagacaagggagccaaaaccaaagagctggccacgtctgcaagccag
agcgcggtgagcacgctgagggacgtggcggggctgagccaggagctgctgaacacatct
gccagcctgtccagggtcaacaccacattacgagagacacaccagcttctgcaggactcc
accatggccactctgttggctggaagaaaagtcaaagacgtggaaattcaagccaacctt
ttgtttgatcggttgaagcctttgaagatgttagaggagaatctgagcagaaacctatca
gaaattaaactgttgatcagccaggcccgcaaacaagcagcttctattaaagtcgccgtg
tctgcagacagagattgcatccgggcctaccagcctcagatttcctctaccaactacaat
accttaacactaaatgttaagacacaggaacccgataatcttctcttctacctcggtagc
agcaccgcttctgatttccttgcagtggagatgcggcgagggagagtggccttcctgtgg
gacctgggctccgggtccacacgcttggagtttccagactttcccattgatgacaacaga
tggcacagtatccatgtagccagatttggaaacattggttcactgagtgtaaaggaaatg
agctcaaatcaaaagtcaccaacaaaaacaagtaaatcccctgggacagctaatgttctg
gatgtaaacaattcaacactcatgtttgttggaggtcttggaggacaaatcaagaaatct
cctgctgtgaaggttactcattttaaaggctgcttgggggaggccttcctgaatggaaaa
tccataggcctatggaactatattgaaagggaaggcaagtgccgtgggtgcttcggaagc
tcccagaatgaagacccttccttccattttgacgggagtgggtactctgtcgtggagaag
tcacttccggctaccgtgacccagataatcatgctttttaataccttttcacctaatgga
cttcttctctacctgggttcatacggcacaaaagactttttatccatcgagctgtttcgt
ggcagagtgaaggttatgactgacctgggttcaggacccattacccttttgacagacaga
cgttataacaatggaacctggtacaaaattgccttccagcgaaaccggaagcaaggagtg
ctagcagttatcgatgcctataacaccagtaataaagaaaccaagcagggcgagactccg
ggagcatcttctgacctcaaccgcctagacaaggacccgatttatgtgggtggattacca
aggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtgggctgcatcaagaac
ctggaaatatccagatcaacctttgacttactcagaaattcctatggagtgagaaaaggc
tgtttactggagcccatccggagtgttagcttcctgaaaggcggctacattgaattgcca
cccaaatctttgtcaccagaatcagaatggctggtaacatttgccaccacgaacagcagt
ggcatcatcctggctgccctcggcggggatgtggagaagcggggtgatcgtgaggaagca
cacgtgcccttcttttccgtcatgctgatcggaggcaacattgaggtacatgtcaatcct
ggggatgggacaggcctgagaaaagctctcctgcacgctcccacgggtacctgcagtgat
ggacaagcgcattccatctccttggtcaggaatcggagaattatcactgtccaattggat
gagaacaatcctgtggaaatgaagttgggcacattagtagaaagcaggacgataaatgtg
tccaatctgtacgtcgggggaattccagagggagaggggacgtcactgctcacaatgaga
agatcgttccatggctgtatcaaaaacctgatcttcaatttggaacttttggatttcaac
agtgcagttggccatgagcaagtcgacctggacacctgctggctgtcagaaaggcctaag
ctggctcccgatgcagaggacagcaagctcttgccagagccccgggcttttccagaacag
tgtgtggtggatgcagctctggagtacgttcccggcgctcaccagtttggtctcacacaa
aacagccatttcatcttgccttttaatcagtcggctgtcagaaagaagctctcggttgag
ctaagcatccgcacgttcgcctccagcggcctgatttactacatggctcatcagaaccaa
gcagactacgctgtgctccagctgcacgggggccgcctccacttcatgtttgaccttggc
aaaggcagaacaaaggtctctcaccctgcactgctcagtgatggcaagtggcacacggtc
aagacagactatgttaaaagaaaaggcttcataactgtcgacggccgagagtctcccatg
gtgactgtggtgggagatggaaccatgctggatgtggagggtttgttctacctaggaggc
ctgccctcccagtaccaggccaggaaaattggaaatatcacccacagcatccctgcctgc
attggggatgtgacggttaacagcaaacagctggacaaggacagcccggtgtctgccttc
acggtgaacaggtgctacgcagtggcccaggaaggaacatactttgacggaagcggatat
gcagctcttgtcaaagagggctacaaagtccagtcagatgtgaacatcacactggagttt
cgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaagtggatgccatt
ggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggtgctggcaggata
acagctgcatatgagcccaaaaccgccactgtgctctgtgatggaaaatggcacactctt
caagctaacaaaagcaaacaccgtatcactctgattgttgacgggaacgcagttggcgct
gaaagtccacacacccagtctacctcagtggacaccaacaatcccatttatgttggtggc
tatcctgctggtgtgaagcaaaaatgcctgcgcagccagacctcgttccgcgggtgtttg
aggaagctagctctgattaagagcccgcaggtgcagtcctttgacttcagcagagcgttc
gaactgcacggagttttccttcattcctgtcctgggaccgagtcctga

KEGG   Homo sapiens (human): 3908
Entry
3908              CDS       T01001                                 

Gene name
LAMA2, LAMM, MDC1A
Definition
(RefSeq) laminin subunit alpha 2
  KO
K05637  laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Disease
H01958  Merosin-deficient congenital muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3908 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3908 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3908 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3908 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3908 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3908 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3908 (LAMA2)
   05414 Dilated cardiomyopathy
    3908 (LAMA2)
   05416 Viral myocarditis
    3908 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3908 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3908 (LAMA2)
   05145 Toxoplasmosis
    3908 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF948
Other DBs
NCBI-GeneID: 3908
NCBI-ProteinID: NP_000417
OMIM: 156225
HGNC: 6482
Ensembl: ENSG00000196569
Vega: OTTHUMG00000015545
Pharos: P24043(Tbio)
UniProt: P24043 Q59H37
Structure
PDB: 
4YEP 4YEQ

Position
6q22.33
AA seq 3122 aa
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ
TGQAYYAILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVD
ENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPV
SFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALL
IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQR
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFH
VDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADT
NDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP
AN
NT seq 9369 nt   +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctccttctgctgctctccggaggcctcgggggcgta
caggcgcagcggccgcagcagcagcggcagtcacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacgaccaatgcaacatgtggagaa
aaaggacctgaaatgtactgcaaattggtagaacatgtccctgggcagcctgtgaggaac
ccgcagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattatgtgacaattaccctggatttacagcaggtgttccagatcgcgtatgtgatt
gtgaaggcagctaactccccccggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagacacggagtgcctaacgctttac
aatatttatccccgcactgggccaccgtcatatgccaaagatgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
gggagaccaagtgccgatgatccttctccagaactgctagaatttacctccgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcgacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaaatctgagtttgaatatacgtggaaagtacattggagggggtgtctgcattaat
tgtacccaaaacactgctggtataaactgcgagacatgtactgatggcttcttcagaccc
aaaggggtatctccaaattatccaaggccatgccagccatgtcattgcgatccaattggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccggactgcaaagcctgtaactgcagtgggttagggagcaaaaatgaggat
ccttgttttggcccctgtatctgcaaggaaaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggggtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgaccttcctggccgcattcgagtggctccccagcaggacgac
ttggactcacctcagcagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcgccggctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgaccttgaagaagaggaagaagatacagaacgtgtt
ctccagcttatgattatcttagagggtaatgacttgagcatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatactaatgtattgttacttaaagaagaatcattt
accatacatggcacacattttccagtccgtagaaaggaatttatgacagtgcttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatccgctgtctcctatcctactgatggaagcattgcagcagct
gtagaagtgtgtcagtgcccaccagggtatactggctcctcttgtgaatcttgttggcct
aggcacaggcgagttaacggcactatttttggtggcatctgtgagccatgtcagtgcttt
ggtcatgcggagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacaca
ggtggcccatattgtgataaatgtcttcctggtttctatggcgagcctactaaaggaacc
tctgaagactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagccca
acgtgccatttagaccggagtcttggattgatctgtgatggatgccctgtcgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgac
agcttgtctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagatgcagttgatgcgaagaactgtcagccctgtcgctgt
aatgccggtggctctttctctgaggtttgccacagtcaaactggacagtgtgagtgcaga
gccaacgttcagggtcagagatgtgacaaatgcaaggctgggacctttggcctacaatca
gcaaggggctgtgttccctgcaactgcaattcttttgggtctaagtcattcgactgtgaa
gagagtggacaatgttggtgccaacctggagtcacagggaagaaatgtgaccgctgtgcc
cacggctatttcaacttccaagaaggaggctgcacagcttgtgaatgttctcatctgggt
aataattgtgacccaaagactgggcgatgcatttgccctcccaataccattggagagaaa
tgttctaaatgtgcacccaatacctggggccacagcattaccactggttgtaaggcttgt
aactgcagcacagtgggatccttggatttccaatgcaatgtaaatacaggccaatgcaac
tgtcatccaaaattctctggtgcaaaatgtacagagtgcagtcgaggtcactggaactac
cctcgctgcaatctctgtgactgcttcctccctgggacagatgccacaacctgtgattca
gagactaaaaaatgctcctgtagtgatcaaactgggcagtgcacttgtaaggtgaatgtg
gaaggcatccactgtgacagatgccggcctggcaaattcggactcgatgccaagaatcca
cttggctgcagcagctgctattgcttcggcactactacccagtgctctgaagcaaaagga
ctgatccggacgtgggtgactctgaaggctgagcagaccattctacccctggtagatgag
gctctgcagcacacgaccaccaagggcattgtttttcaacatccagagattgttgcccac
atggacctgatgagagaagatctccatttggaacctttttattggaaacttccagaacaa
tttgaaggaaagaagttgatggcctatgggggcaaactcaagtatgcaatctatttcgag
gctcgggaagaaacaggtttctctacatataatcctcaagtgatcattcgaggtgggaca
cctactcatgctagaattatcgtcaggcatatggctgctcctctgattggccaattgaca
aggcatgaaattgaaatgacagagaaagaatggaaatattatggggatgatcctcgagtc
catagaactgtgacccgagaagacttcttggatatactatatgatattcattacattctt
atcaaagctacttatggaaatttcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgtggaacaacaatgactcctccagctgacttgattgaaaaatgt
gattgtcccctgggctattctggcctgtcctgtgaggcatgcttgccgggattttatcga
ctgcgttctcaaccaggtggccgcacccctggaccaaccctgggcacctgtgttccatgt
caatgtaatggacacagcagcctgtgtgaccctgaaacatcgatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacgatgtgctcttggatactatggaattgtcaag
ggattgccaaatgactgtcagcaatgtgcctgccctctgatttcttccagtaacaatttc
agcccctcttgtgtcgcagaaggacttgacgactaccgctgcacggcttgtccacgggga
tatgaaggccagtactgtgaaaggtgtgcccctggctatactggcagtccaggcaaccct
ggaggctcctgccaagaatgtgagtgtgatccctatggctcactgcctgtgccctgtgac
cctgtcacaggattctgcacgtgccgacctggagccacgggaaggaagtgtgacggctgc
aagcactggcatgcacgcgagggctgggagtgtgttttttgtggagatgagtgcactggc
cttcttctcggtgacttggctcgcctggagcagatggtcatgagcatcaacctcactggt
ccgctgcctgcgccatataaaatgctgtatggtcttgaaaatatgactcaggagctaaag
cacttgctgtcacctcagcgggccccagagaggcttattcagctggcagagggcaatctg
aatacactcgtgaccgaaatgaacgagctgctgaccagggctaccaaagtgacagcagat
ggcgagcagaccggacaggatgctgagaggaccaacacaagagcaaagtccctgggagaa
ttcattaaggagcttgcccgggatgcagaagctgtaaatgaaaaagctataaaactaaat
gaaactctaggaactcgagacgaggcctttgagagaaatttggaagggcttcagaaagag
attgaccagatgattaaagaactgaggaggaaaaatctagagacacaaaaggaaattgct
gaagatgagttggtagctgcagaagcccttctgaaaaaagtgaagaagctgtttggagag
tcccggggggaaaatgaagaaatggagaaggatctccgggaaaaactggctgactacaaa
aacaaagttgatgatgcttgggaccttttgagagaagccacagataaaatcagagaagct
aatcgcctatttgcagtaaatcagaaaaacatgactgcattggagaaaaagaaggaggct
gttgaaagcggcaaacgacaaattgagaacactttaaaagagggcaatgacatactcgat
gaagccaaccgtcttgcagatgaaatcaactccatcatagactatgttgaagacatccaa
actaaattgccacctatgtctgaggagcttaatgataaaatagatgacctctcccaagaa
ataaaggacaggaagcttgctgagaaggtgtcccaggctgagagccacgcagctcagttg
aatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatattaaggactatattgatgaagctgagaaa
gttgccaaagaagccaaagatcttgcacatgaagctacaaaactggcaacaggtcctcgg
ggtttattaaaggaagatgccaaaggctgtcttcagaaaagcttcaggattcttaacgaa
gccaagaagttagcaaatgatgtaaaagaaaatgaagaccatctaaatggcttaaaaacc
aggatagaaaatgctgatgctagaaatggggatctcttgagaactttgaatgacactttg
ggaaagttatcagctattccaaatgatacagctgctaaactgcaagctgttaaggacaaa
gccagacaagccaacgacacagctaaagatgtactggcacagattacagagctccaccag
aacctcgatggcctgaagaagaattacaataaactagcagacagcgtcgccaaaacgaat
gctgtggttaaagatccttccaagaacaaaatcattgccgatgcagatgccactgtcaaa
aatttagaacaggaagctgaccggctaatagataaactcaaacccatcaaggaacttgag
gataacctaaagaaaaacatctctgagataaaggaattgataaaccaagctcggaaacaa
gccaattctatcaaagtatctgtgtcttcaggaggtgactgcattcgaacatacaaacca
gaaatcaagaaaggaagttacaataatattgttgtcaacgtaaagacagctgttgctgat
aacctcctcttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgt
aaaggcaaagtcagcttcctctgggatgttggatctggagttggacgtgtagagtaccca
gatttgactattgatgactcatattggtaccgtatcgtagcatcaagaactgggagaaat
ggaactatttctgtgagagccctggatggacccaaagccagcattgtgcccagcacacac
cattcgacgtctcctccagggtacacgattctagatgtggatgcaaatgcaatgctgttt
gttggtggcctgactgggaaattaaagaaggctgatgctgtacgtgtgattacattcact
ggctgcatgggagaaacatactttgacaacaaacctataggtttgtggaatttccgagaa
aaagaaggtgactgcaaaggatgcactgtcagtcctcaggtggaagatagtgaggggact
attcaatttgatggagaaggttatgcattggtcagccgtcccattcgctggtaccccaac
atctccactgtcatgttcaagttcagaacattttcttcgagtgctcttctgatgtatctt
gccacacgagacctgagagatttcatgagtgtggagctcactgatgggcacataaaagtc
agttacgatctgggctcaggaatggcttccgttgtcagcaatcaaaaccataatgatggg
aaatggaaatcattcactctgtcaagaattcaaaaacaagccaatatatcaattgtagat
atagatactaatcaggaggagaatatagcaacttcgtcttctggaaacaactttggtctt
gacttgaaagcagatgacaaaatatattttggtggcctgccaacgctgagaaacttgagt
atgaaagcaaggccagaagtaaatctgaagaaatattccggctgcctcaaagatattgaa
atttcaagaactccgtacaatatactcagtagtcccgattatgttggtgttaccaaagga
tgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggagctctcc
cctgtgccaattgatgtaggaacagaaatcaacctgtcattcagcaccaagaatgagtcc
ggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacgaaggcag
actggacaggcctattatgcaatactcctcaacaggggccgtctggaagtgcatctctcc
acaggggcacgaacaatgaggaaaattgtgatcagaccagagccgaatctgtttcatgat
ggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaagtggat
gaaaacagaagatacatgcaaaacctgacagttgaacagcctatcgaagttaaaaagctt
ttcgttgggggtgctccacctgaatttcaaccttccccactcagaaatattcctcctttt
gaaggctgcatatggaatcttgttattaactctgtccccatggactttgcaaggcctgtg
tccttcaaaaatgctgacattggtcgctgtgcccatcagaaactccgtgaagatgaagat
ggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcctttcct
acgcccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagctcttttg
atagggagcaagcagttcgggctttcaagaaacagtcacattgcaattgcatttgatgac
accaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaatccggc
ttgcttttttacatggctcgcatcaatcatgctgattttgcaacagttcagctgagaaat
ggattgccctacttcagctatgacttggggagtggggacacccacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaaggaatt
ctttatgtagatggggcttccaacagaaccatcagtcccaaaaaagccgacatcctggat
gtcgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaagaattggt
ccagtgacctatagcattgatggctgcgtcaggaatctccacatggcagaggcccctgcc
gatctggaacaacccacctccagcttccatgttgggacatgttttgcaaatgctcagagg
ggaacatattttgacggaaccggttttgccaaagcagttggtggattcaaagtgggattg
gaccttcttgtagaatttgaattccgcacaactacaacgactggagttcttctggggatc
agtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagttgatgtttcat
gtggacaatggtgcgggcagattcactgctgtctatgatgctggggttccagggcatttg
tgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgagctcaca
gtcgatgggaaccaggtggaagcccaaagcccaaacccagcatctacatcagctgacaca
aatgaccctgtgtttgttggaggcttcccagatgacctcaagcagtttggcctaacaacc
agtattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacaggcaagcca
ctggaggttaattttgccaaggccctggaactgaggggcgttcaacctgtatcatgccca
gccaactaa

DBGET integrated database retrieval system