KEGG   Homo sapiens (human): 284252Help
Entry
284252            CDS       T01001                                 

Gene name
KCTD1, C18orf5
Definition
(RefSeq) potassium channel tetramerization domain containing 1
  KO
K21754  BTB/POZ domain-containing protein KCTD1/15
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     284252 (KCTD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB_2
Motif
Other DBs
NCBI-GeneID: 284252
NCBI-ProteinID: NP_001129677
OMIM: 613420
HGNC: 18249
Ensembl: ENSG00000134504
Vega: OTTHUMG00000131947
Pharos: Q719H9(Tbio)
UniProt: Q719H9 A0A024RC45
Structure
PDB: 

Position
18q11.2
AA seq 257 aa AA seqDB search
MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLF
DGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPM
LLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVN
AGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELR
RTPRVPSVIRIKQEPLD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacctctgatcactagatcccctgcatctccactgaacaaccaaggcatccct
actccagcacaactcacaaaatccaatgcgcctgtccacattgatgtgggcggccacatg
tacaccagcagcctggccaccctcaccaaataccctgaatccagaatcggaagacttttt
gatggtacagagcccattgttttggacagtctcaaacagcactatttcattgacagagat
ggacagatgttcagatatatcttgaattttctacgaacatccaaactcctcattcctgat
gatttcaaggactacactttgttatatgaagaggcaaaatattttcagcttcagcccatg
ttgttggagatggaaagatggaagcaggacagagaaactggtcgattttcaaggccctgt
gagtgcctcgtcgtgcgtgtggccccagacctcggagaaaggatcacgctaagcggtgac
aaatccttgatagaagaagtatttccagagatcggcgacgtgatgtgtaactctgtcaat
gcaggctggaatcacgactcgacgcacgtcatcaggtttccactaaatggctactgtcac
ctcaactcagtccaggtcctcgagaggttgcagcaaagaggatttgaaatcgtgggctcc
tgtgggggaggagtagactcgtcccagttcagcgaatacgtccttcggcgggaactgagg
cggacgccccgtgtaccctccgtcatccggataaagcaagagcctctggactaa

DBGET integrated database retrieval system