KEGG   Homo sapiens (human): 284355
Entry
284355            CDS       T01001                                 
Symbol
TPRX1, TPRX
Name
(RefSeq) tetrapeptide repeat homeobox 1
  KO
K24905  tetra-peptide repeat homeobox protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    284355 (TPRX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    284355 (TPRX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 284355
NCBI-ProteinID: NP_940881
OMIM: 611166
HGNC: 32174
Ensembl: ENSG00000178928
UniProt: Q8N7U7 D2CFI5
Position
19:complement(47801232..47819051)
AA seq 508 aa
MDEAGNHHSEQTITRTENQTPHALAHRRMGPCLSCSQLYSQYLGLSQTHSSPPLALDPPR
RQRQERTVYTESQQKVLEFYFQKDQYPNYDQRLNLAEMLSLREQQLQVWFKNRRAKLARE
RRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPSGILPAAEPTICSLHQAWGGPGCR
AQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGPIPGPAQIPSPIPAPIPGPISGPV
QIPGPFRGPIPGPISGPAPIPGPISGPFSGPNPGPIPGPNPGPIPGPISGPIPGPISVPI
PGPIPGPISGPISGPNPGPIPGPIPGPISGPNPGPIPGPISGPNPGLIPGPIPGPISGPG
PIIGPIPSPAQIPGPGRLQGPGPILSPGRMRSPGSLPGLAPILGPGSGPGSGSVPAPIPG
PGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMG
KKHSGSQPQEEGGSVNENHSGPRLLLDL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggatgaagctggaaaccatcattctgagcaaactatcacaaggacagaaaaccaaaca
ccgcatgctctcgctcataggaggatggggccctgtctgtcttgttctcagctgtattcc
cagtacctaggactgtcccagacacacagcagccctcccctggccctggaccctccaagg
agacagcggcaggagcgcacggtctacactgaaagccagcagaaagtgctagaattttac
tttcagaaggaccagtacccgaactacgaccagcgactgaatctggcggagatgctcagc
ctcagggagcaacagctgcaggtgtggttcaagaatcgccgcgccaaactagctcgggag
cggcggctccagcagcagccccagcgcgtccctgggcagagaggccgaggagcccgcgct
gcgcccctagtccctgcagcctctgcctccgcacctcagcggggcccctcgggaatcctt
ccagcggcggaacccacgatctgcagcctccaccaggcctggggtggccctgggtgcaga
gcccagaagggcatcccagctgccctgagtccaggccctggcccgatccctgccccaatc
ccaggcccagcccagatcccaggcccactccctggctcaattccaggcccaattccaggc
ccagctcagatcccaagcccgatcccagccccaatcccaggcccaatttcaggcccagtc
cagatcccaggcccattccgtggcccaatcccaggcccaatttcaggcccagccccgatc
ccaggcccaatctcaggcccattctcaggcccaaacccaggcccgatcccaggcccaaac
ccaggcccgatcccaggcccaatctcaggcccgatcccaggcccaatctcagtcccgatc
ccaggcccgatcccaggcccaatctcaggcccaatctcaggcccaaacccaggcccgatc
ccaggcccaatcccaggcccaatctcaggcccgaacccaggcccgatcccaggcccaatc
tcaggcccgaacccaggcctgatcccaggcccaatcccaggcccaatctcaggcccaggc
ccaattataggcccgattcccagcccagcccagatcccaggcccaggcagactccaaggc
ccaggtcccatcttaagtcctggccggatgcgaagccctggctcacttccaggcctagcc
ccgattttaggcccaggctcaggcccaggctcaggctcagtcccagctccaatcccaggc
ccaggatcactcccagccccagcccccttatggcctcagagccccgatgcctccgacttc
ttgccagacacccagttattccctcacttcacagagctgctcctacccctagaccccttg
gagggatcctcagtctccaccatgacctctcagtaccaagaaggggatgactctatgggc
aaaaaacactcagggtctcagccccaagaggagggtggctctgtgaatgaaaatcactca
ggccccaggttattactggatttatag

DBGET integrated database retrieval system