KEGG   Homo sapiens (human): 284361
Entry
284361            CDS       T01001                                 
Symbol
EMC10, C19orf63, HSM1, HSS1, NEDDFAS
Name
(RefSeq) ER membrane protein complex subunit 10
  KO
K23570  ER membrane protein complex subunit 10
Organism
hsa  Homo sapiens (human)
Disease
H02535  Neurodevelopmental disorder with dysmorphic facies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    284361 (EMC10)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   ER membrane protein complex
    284361 (EMC10)
SSDB
Other DBs
NCBI-GeneID: 284361
NCBI-ProteinID: NP_996261
OMIM: 614545
HGNC: 27609
Ensembl: ENSG00000161671
Vega: OTTHUMG00000183042
Pharos: Q5UCC4(Tbio)
UniProt: Q5UCC4
Structure
Position
19:50476507..50490871
AA seq 262 aa
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSF
EIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALD
GLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLEL
FNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMS
GAPDTGGQGGGGGGGGGGGSGR
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcggcagccagcgctggggcaacccggctgctcctgctcttgctgatggcggtagca
gcgcccagtcgagcccggggcagcggctgccgggccgggactggtgcgcgaggggctggg
gcggaaggtcgagagggcgaggcctgtggcacggtggggctgctgctggagcactcattt
gagatcgatgacagtgccaacttccggaagcggggctcactgctctggaaccagcaggat
ggtaccttgtccctgtcacagcggcagctcagcgaggaggagcggggccgactccgggat
gtggcagccctgaatggcctgtaccgggtccggatcccaaggcgacccggggccctggat
ggcctggaagctggtggctatgtctcctcctttgtccctgcgtgctccctggtggagtcg
cacctgtcggaccagctgaccctgcacgtggatgtggccggcaacgtggtgggcgtgtcg
gtggtgacgcaccccgggggctgccggggccatgaggtggaggacgtggacctggagctg
ttcaacacctcggtgcagctgcagccgcccaccacagccccaggccctgagacggcggcc
ttcattgagcgcctggagatggaacaggcccagaaggccaagaacccccaggagcagaag
tccttcttcgccaaatactggatgtacatcattcccgtcgtcctgttcctcatgatgtca
ggagcgccagacaccgggggccagggtgggggtgggggtgggggtggtggtgggggtagt
ggccggtga

DBGET integrated database retrieval system