KEGG   Homo sapiens (human): 284383
Entry
284383            CDS       T01001                                 

Gene name
OR2Z1, OR19-4, OR2Z2
Definition
(RefSeq) olfactory receptor family 2 subfamily Z member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    284383 (OR2Z1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    284383 (OR2Z1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    284383 (OR2Z1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv Adeno_E3_15_3 DUF825
Other DBs
NCBI-GeneID: 284383
NCBI-ProteinID: NP_001004699
HGNC: 15391
Ensembl: ENSG00000181733
Vega: OTTHUMG00000182195
Pharos: Q8NG97(Tdark)
UniProt: Q8NG97 A0A126GVT8
Position
19p13.2
AA seq 314 aa
MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMY
FLLSQLSLFDIGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSY
DRYVAVCQPLQYPVLMRRQVCLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCE
VPALLKLSCADTCAYEMALSTSGVLILMLPLSLIATSYGHVLQAVLSMRSEEARHKAVTT
CSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNPEVWMA
LVKVLSRAGLRQMC
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggggatgtgaatcagtcggtggcctcagacttcattctggtgggcctcttcagtcac
tcaggatcacgccagctcctcttctccctggtggctgtcatgtttgtcataggccttctg
ggcaacaccgttcttctcttcttgatccgtgtggactcccggctccacacacccatgtac
ttcctgctcagccagctctccctgtttgacattggctgtcccatggtcaccatccccaag
atggcatcagactttctgcggggagaaggtgccacctcctatggaggtggtgcagctcaa
atattcttcctcacactgatgggtgtggctgagggcgtcctgttggtcctcatgtcttat
gaccgttatgttgctgtgtgccagcccctgcagtatcctgtacttatgagacgccaggta
tgtctgctgatgatgggctcctcctgggtggtaggtgtgctcaacgcctccatccagacc
tccatcaccctgcattttccctactgtgcctcccgtattgtggatcacttcttctgtgag
gtgccagccctactgaagctctcctgtgcagatacctgtgcctacgagatggcgctgtcc
acctcaggggtgctgatcctaatgctccctctttccctcatcgccacctcctacggccac
gtgttgcaggctgttctaagcatgcgctcagaggaggccagacacaaggctgtcaccacc
tgctcctcgcacatcacggtagtggggctcttttatggtgccgccgtgttcatgtacatg
gtgccttgcgcctaccacagtccacagcaggataacgtggtttccctcttctatagcctt
gtcacccctacactcaacccccttatctacagtctgaggaatccggaggtgtggatggct
ttggtcaaagtgcttagcagagctggactcaggcaaatgtgctga

DBGET integrated database retrieval system