KEGG   Homo sapiens (human): 284427
Entry
284427            CDS       T01001                                 

Gene name
SLC25A41, APC4, SCaMC-3L
Definition
(RefSeq) solute carrier family 25 member 41
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    284427 (SLC25A41)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   284427 (SLC25A41)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 284427
NCBI-ProteinID: NP_775908
OMIM: 610822
HGNC: 28533
Ensembl: ENSG00000181240
Vega: OTTHUMG00000180851
Pharos: Q8N5S1(Tdark)
UniProt: Q8N5S1
Position
19p13.3
AA seq 370 aa
MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDN
NLEHLPSQQVLDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYM
QVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGI
QGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRA
LYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMAS
YPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVV
YEAMKKTLGI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggcgctcagcctggggaacctcagaacacttgctctaggatccagacactgtttagg
agggtcaagaccttactcatcaaagccccgcctcccccccaacctccgcctccaccccca
tcctggaaccctggctgtacacacgtgtatgggtacgcgtttggccacatgcatgacaac
aaccttgaacatctcccgtcacagcaggtactggacacaggagagcagctgatggtcccc
gtggaagtcctggaagtggataacaaggaggccttgtggaagtttctactctcaggagct
atggccggggcggtgtctcgcacgggcacggcacctctggacagagccaaggtgtacatg
caggtctactcctccaagacgaacttcaccaacctgctgggggggctacagagcatggtc
caggagggcggcttccgctccctgtggcggggcaacggcatcaacgtgctcaagattgct
cctgagtatgccatcaagttctccgtattcgagcagtgcaagaattacttctgtggaata
caagggtccccgcccttccaggagcgtctccttgctggctccctggctgtggccatctcc
cagaccctcatcaaccccatggaggtgctgaagacgcggttgaccttgcgtcggacgggc
cagtacaaggggctgctggactgcgccaggcagatcttgcagcgagagggcacccgcgcc
ctttaccgcggctacctgcccaatatgctcggcatcatcccctatgcctgcaccgacctg
gctgtctatgagatgctccagtgcttctgggtgaagtcaggcagggatatgggggacccc
agtggcctggtcagtctgtcgtctgtgacgctatccacgacctgtggccagatggccagc
tacccactgactctggtgcgcaccaggatgcaggcccaagataccgtggagggctcaaat
cccaccatgcgcggagtcctccagcggatcctggcccagcagggctggctagggctgtac
cgaggcatgacccccacgctactgaaggtcttaccagcaggtggcatcagctatgtggtg
tacgaagccatgaagaaaaccctgggcatatag

DBGET integrated database retrieval system