KEGG   Homo sapiens (human): 284439
Entry
284439            CDS       T01001                                 
Symbol
SLC25A42, MECREN
Name
(RefSeq) solute carrier family 25 member 42
  KO
K15085  solute carrier family 25, member 42
Organism
hsa  Homo sapiens (human)
Disease
H02701  Recurrent metabolic crises with variable encephalomyopathic features and neurologic regression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    284439 (SLC25A42)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   284439 (SLC25A42)
SSDB
Motif
Pfam: Mito_carr Chorismate_bind
Other DBs
NCBI-GeneID: 284439
NCBI-ProteinID: NP_001308473
OMIM: 610823
HGNC: 28380
Ensembl: ENSG00000181035
UniProt: Q86VD7
Position
19:19063994..19113030
AA seq 318 aa
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGS
YYGFRGEALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE
EGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIG
QSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVG
ISFTTFDLMQILLRHLQS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgggtaatggtgtgaaggaaggcccggtgcgattgcatgaggatgctgaggctgtcctg
tcctcgtccgtctcatcaaagcgtgaccacaggcaagtgctcagctccctgctgtctggg
gccctggctggtgcccttgccaaaacagcggtagctcccctggaccgaaccaaaatcatc
ttccaagtgtcttcaaaaagattttctgccaaggaggccttccgggtcctctactacacc
tacctcaacgagggatttctcagcttgtggcgcgggaactcggccaccatggtgcgcgtg
gtgccctacgccgccatccagttcagcgcacacgaggagtacaagcgcatcctgggcagc
tactatggcttccgtggagaagccctgcccccttggcctcgcctcttcgccggcgcactg
gctggaacgacagccgcttcactgacctaccccctggacctggtcagagcgcggatggcc
gtaaccccgaaggaaatgtacagcaacatctttcatgtcttcatccgcatctcgagagaa
gaggggctgaagactctctaccatggatttatgcccaccgtgctgggggtcattccctac
gctggcctgagcttcttcacctatgagacgctcaagagcttgcacagagagtacagcggc
cgccggcagccctaccccttcgagcgcatgatcttcggcgcctgcgctggcctcatcggg
cagtcggcctcgtacccgctggatgtggtgcggcggcgcatgcagacggccggcgtcacg
ggctacccgcgcgcctccatcgcccgcacgctgcgcaccatcgtgcgggaggagggcgcc
gtgcgcggcctctacaaaggcttgagcatgaactgggtcaagggtcccatcgccgtgggc
atcagcttcaccaccttcgacctcatgcagatcctgctgcggcacctgcagagctag

DBGET integrated database retrieval system