KEGG   Homo sapiens (human): 284486
Entry
284486            CDS       T01001                                 

Gene name
THEM5, ACOT15
Definition
(RefSeq) thioesterase superfamily member 5
  KO
K22554  acyl-coenzyme A thioesterase THEM5 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    284486 (THEM5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     284486 (THEM5)
SSDB
Motif
Pfam: 4HBT
Other DBs
NCBI-GeneID: 284486
NCBI-ProteinID: NP_872384
OMIM: 615653
HGNC: 26755
Ensembl: ENSG00000196407
Vega: OTTHUMG00000013070
Pharos: Q8N1Q8(Tbio)
UniProt: Q8N1Q8
Structure
PDB: 
4AE7

Position
1q21.3
AA seq 247 aa
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNA
SWCSDMLSLYQEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCI
QVEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEG
LFTLSLNIRFKNLIPVDSLVVMDVELDKIEDQKLYMSCIAHSRDQQTVYAKSSGVFLQLQ
LEEESPQ
NT seq 744 nt   +upstreamnt  +downstreamnt
atgataaggagatgcttccaggtggcagcaagacttggccaccacagaggccttcttgag
gccccccgtatcctgcccagactcaaccctgcctcagcatttggatcctccacagactcc
atgttctcaagattcttgccagagaagacagacttgaaggattatgctcttcccaatgcc
agctggtgttcggacatgctgagcctgtaccaagaatttctggagaagactaagtctagc
ggctggatcaagctgccctccttcaagtccaacagagaccacatccggggactcaagctc
ccatctggactggcagtttcctcagacaaaggtgactgtcgcatcttcaccaggtgcatc
caagtggaaggacaaggctttgagtatgtcatctttttccagccaacccagaagaagtcg
gtctgtcttttccaaccaggctcctacctggaggggcccccagggtttgctcacggcggg
tccctggcagccatgatggacgagaccttttctaaaactgccttcctggctggagagggg
ctgttcacactaagtctcaacatcaggttcaaaaacttgatccccgtggactctctggtt
gtaatggacgtagaactggacaagattgaggaccagaagctttacatgtcctgcatcgcc
cacagcagagaccagcagacagtttatgccaagtcctcaggtgttttccttcagctgcag
ttggaagaagagtctccccagtaa

DBGET integrated database retrieval system