KEGG   Homo sapiens (human): 2845Help
Entry
2845              CDS       T01001                                 

Gene name
GPR22
Definition
(RefSeq) G protein-coupled receptor 22
  KO
K04319  G protein-coupled receptor 22
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2845 (GPR22)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    2845 (GPR22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Pex24p
Motif
Other DBs
NCBI-GeneID: 2845
NCBI-ProteinID: NP_005286
OMIM: 601910
HGNC: 4477
Ensembl: ENSG00000172209
Vega: OTTHUMG00000154902
Pharos: Q99680(Tbio)
UniProt: Q99680 B3KV13 Q3KNS9
Position
7q22.3
AA seq 433 aa AA seqDB search
MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNL
TVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEA
CVSFASVSTAINVFAITLDRYDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVN
FFSLQSGNTWENKTLLCVSTNEYYTELGMYYHLLVQIPIFFFTVVVMLITYTKILQALNI
RIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNVVFGVRTSVSVIIALRRAVKR
HRERRERQKRVFRMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRLCFLVMAYGTT
IFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSE
IREKCLVPQVVTD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttttctcccattctggaaatcaacatgcagtctgaatctaacattacagtgcga
gatgacattgatgacatcaacaccaatatgtaccaaccactatcatatccgttaagcttt
caagtgtctctcaccggatttcttatgttagaaattgtgttgggacttggcagcaacctc
actgtattggtactttactgcatgaaatccaacttaatcaactctgtcagtaacattatt
acaatgaatcttcatgtacttgatgtaataatttgtgtgggatgtattcctctaactata
gttatccttctgctttcactggagagtaacactgctctcatttgctgtttccatgaggct
tgtgtatcttttgcaagtgtctcaacagcaatcaacgtttttgctatcactttggacaga
tatgacatctctgtaaaacctgcaaaccgaattctgacaatgggcagagctgtaatgtta
atgatatccatttggattttttcttttttctctttcctgattccttttattgaggtaaat
tttttcagtcttcaaagtggaaatacctgggaaaacaagacacttttatgtgtcagtaca
aatgaatactacactgaactgggaatgtattatcacctgttagtacagatcccaatattc
tttttcactgttgtagtaatgttaatcacatacaccaaaatacttcaggctcttaatatt
cgaataggcacaagattttcaacagggcagaagaagaaagcaagaaagaaaaagacaatt
tctctaaccacacaacatgaggctacagacatgtcacaaagcagtggtgggagaaatgta
gtctttggtgtaagaacttcagtttctgtaataattgccctccggcgagctgtgaaacga
caccgtgaacgacgagaaagacaaaagagagtcttcaggatgtctttattgattatttct
acatttcttctctgctggacaccaatttctgttttaaataccaccattttatgtttaggc
ccaagtgaccttttagtaaaattaagattgtgttttttagtcatggcttatggaacaact
atatttcaccctctattatatgcattcactagacaaaaatttcaaaaggtcttgaaaagt
aaaatgaaaaagcgagttgtttctatagtagaagctgatcccctgcctaataatgctgta
atacacaactcttggatagatcctaaaagaaacaaaaaaattacctttgaagatagtgaa
ataagagaaaaatgtttagtgcctcaggttgtcacagactag

DBGET integrated database retrieval system