KEGG   Homo sapiens (human): 284612
Entry
284612            CDS       T01001                                 

Gene name
SYPL2, MG29
Definition
(RefSeq) synaptophysin like 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 284612
NCBI-ProteinID: NP_001035799
HGNC: 27638
Ensembl: ENSG00000143028
Vega: OTTHUMG00000010969
Pharos: Q5VXT5(Tbio)
UniProt: Q5VXT5
Position
1p13.3
AA seq 272 aa
MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET
GAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVT
LGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG
ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH
GQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtcctcgaccgagagcgccggccgcacggcggacaagtcgccgcgccagcaggtggac
cgcctactcgtggggctgcgctggcggcggctggaggagccgctgggcttcatcaaagtt
ctccagtggctctttgctattttcgccttcgggtcctgtggctcctacagcggggagaca
ggagcaatggttcgctgcaacaacgaagccaaggacgtgagctccatcatcgttgcattt
ggctatcccttcaggttgcaccggatccaatatgagatgcccctctgcgatgaagagtcc
agctccaagaccatgcacctcatgggggacttctctgcacccgccgagttcttcgtgacc
cttggcatcttttccttcttctataccatggctgccctagttatctacctgcgcttccac
aacctctacacagagaacaaacgcttcccgctggtggacttctgtgtgactgtctccttc
accttcttctggctggtagctgcagctgcctggggcaagggcctgaccgatgtcaagggg
gccacacgaccatccagcttgacagcagccatgtcagtgtgccatggagaggaagcagtg
tgcagtgccggggccacgccctctatgggcctggccaacatctccgtgctctttggcttt
atcaacttcttcctgtgggccgggaactgttggtttgtgttcaaggagaccccgtggcat
ggacagggccagggccaggaccaggaccaggaccaggaccagggccagggtcccagccag
gagagtgcagctgagcagggagcagtggagaagcagtaa

DBGET integrated database retrieval system