KEGG   Homo sapiens (human): 284613
Entry
284613            CDS       T01001                                 
Symbol
CYB561D1
Name
(RefSeq) cytochrome b561 family member D1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cytochrom_B561 DUF5652
Other DBs
NCBI-GeneID: 284613
NCBI-ProteinID: NP_872386
HGNC: 26804
Ensembl: ENSG00000174151
Pharos: Q8N8Q1(Tdark)
UniProt: Q8N8Q1 Q6ZQS1
Position
1:109494094..109500435
AA seq 229 aa
MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMA
LAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSEL
PHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT
VLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagcccctggaggtaggtctggttcccgctccagctggggagccgagactgacccgc
tggctgcggagaggcagtgggatcttggcgcacctggtagctttgggcttcaccatcttt
ctgacagcgctgtcccggccaggaaccagtcttttctcctggcaccctgtattcatggcc
ttggcgttctgcctctgcatggctgaagccatcctactcttctcacctgaacactccctg
ttcttcttctgctcccgaaaagcacggatccggctccactgggcagggcagaccctagcc
atcctctgtgcagctctgggcctgggcttcatcatctccagcaggacccgcagtgagctg
cctcatctggtgtcctggcacagctgggtgggagccctgacactgctggccactgctgtc
caggcactgtgtgggctctgcctcctttgtccccgggcagccagggtctcaagggtggct
cgcctcaagctctaccatctgacatgtggactggtggtctacctgatggctacagtaacg
gtgcttctgggcatgtactcagtatggttccaggcccagatcaaaggtgcggcctggtac
ctgtgcctggcactgcccgtctatccagccctggtgatcatgcaccagatttccagatcc
tacttgccgaggaagaaaatggaaatgtga

DBGET integrated database retrieval system