KEGG   Homo sapiens (human): 2847
Entry
2847              CDS       T01001                                 

Gene name
MCHR1, GPR24, MCH-1R, MCH1R, SLC-1, SLC1
Definition
(RefSeq) melanin concentrating hormone receptor 1
  KO
K04320  melanin-concentrating hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2847 (MCHR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2847 (MCHR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Melanin-concentrating hormone (MCH)
    2847 (MCHR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2847
NCBI-ProteinID: NP_005288
OMIM: 601751
HGNC: 4479
Ensembl: ENSG00000128285
Vega: OTTHUMG00000150256
Pharos: Q99705(Tchem)
UniProt: Q99705
Position
22q13.2
AA seq 353 aa
MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNST
VIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggacctggaagcctcgctgctgcccactggtcccaacgccagcaacacctctgatggc
cccgataacctcacttcggcaggatcacctcctcgcacggggagcatctcctacatcaac
atcatcatgccttcggtgttcggcaccatctgcctcctgggcatcatcgggaactccacg
gtcatcttcgcggtcgtgaagaagtccaagctgcactggtgcaacaacgtccccgacatc
ttcatcatcaacctctcggtagtagatctcctctttctcctgggcatgcccttcatgatc
caccagctcatgggcaatggggtgtggcactttggggagaccatgtgcaccctcatcacg
gccatggatgccaatagtcagttcaccagcacctacatcctgaccgccatggccattgac
cgctacctggccactgtccaccccatctcttccacgaagttccggaagccctctgtggcc
accctggtgatctgcctcctgtgggccctctccttcatcagcatcacccctgtgtggctg
tatgccagactcatccccttcccaggaggtgcagtgggctgcggcatacgcctgcccaac
ccagacactgacctctactggttcaccctgtaccagtttttcctggcctttgccctgcct
tttgtggtcatcacagccgcatacgtgaggatcctgcagcgcatgacgtcctcagtggcc
cccgcctcccagcgcagcatccggctgcggacaaagagggtgacccgcacagccatcgcc
atctgtctggtcttctttgtgtgctgggcaccctactatgtgctacagctgacccagttg
tccatcagccgcccgaccctcacctttgtctacttatacaatgcggccatcagcttgggc
tatgccaacagctgcctcaacccctttgtgtacatcgtgctctgtgagacgttccgcaaa
cgcttggtcctgtcggtgaagcctgcagcccaggggcagcttcgcgctgtcagcaacgct
cagacggctgacgaggagaggacagaaagcaaaggcacctga

DBGET integrated database retrieval system