KEGG   Homo sapiens (human): 284723
Entry
284723            CDS       T01001                                 

Gene name
SLC25A34
Definition
(RefSeq) solute carrier family 25 member 34
  KO
K15117  solute carrier family 25, member 34/35
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    284723 (SLC25A34)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   284723 (SLC25A34)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 284723
NCBI-ProteinID: NP_997231
OMIM: 610817
HGNC: 27653
Ensembl: ENSG00000162461
Vega: OTTHUMG00000003063
Pharos: Q6PIV7(Tdark)
UniProt: Q6PIV7
Position
1p36.21
AA seq 304 aa
METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAV
ARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAFV
GSPAYLIKTQLQAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVG
SAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQPVD
TAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQ
HKGT
NT seq 915 nt   +upstreamnt  +downstreamnt
atggagacggtgcccccagcagtggacctggtgctgggtgcttctgcctgctgcctggcc
tgtgtcttcaccaaccccctggaggtggtgaagacgcggctgcagctgcagggggagctg
caggcccggggcacctacccacggccctaccatggcttcatagcctctgtcgctgctgtg
gcccgagcagacgggctgtggggcctgcagaaggggctggctgccggccttctgtaccaa
ggcctcatgaatggcgttcgtttctactgctacagcctggcgtgccaggctggcctcacg
cagcaaccaggtggcaccgtggttgcgggagccgtggcgggggcactgggagccttcgtg
gggagccctgcttacctgatcaaaacgcagctgcaagctcagacagtggccgcagtggcc
gtgggacaccagcacaatcaccagactgtcctgggtgccttggagaccatctggcggcag
caagggctcttggggctgtggcagggcgttggtggggctgtgccccgagtcatggtgggc
tcagctgcccagctggccaccttcgcctctgccaaggcctgggtacagaagcaacagtgg
ctccctgaggacagctggctggtggccctggctgggggcatgatcagcagcatagccgtg
gttgtcgtcatgactcccttcgatgtggtcagcacgcggctatacaatcagccggtggac
acagctggcaggggccagctctatgggggcctcaccgactgcatggtgaagatctggcgg
caggagggccccctggcactctacaagggcctgggccccgcctacctgcgcctgggcccc
cacaccatcctcagcatgctcttctgggacgagcttcggaaactggctgggcgggcccag
cacaagggcacctag

DBGET integrated database retrieval system