KEGG   Homo sapiens (human): 2848
Entry
2848              CDS       T01001                                 

Gene name
GPR25
Definition
(RefSeq) G protein-coupled receptor 25
  KO
K08405  G protein-coupled receptor 25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2848 (GPR25)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    2848 (GPR25)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2848
NCBI-ProteinID: NP_005289
OMIM: 602174
HGNC: 4480
Ensembl: ENSG00000170128
Vega: OTTHUMG00000035788
Pharos: O00155(Tdark)
UniProt: O00155
Position
1q32.1
AA seq 361 aa
MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFV
VWLLAGRRGPRRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALA
GTRCAGALLLAGMSVDRYLAVVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGL
QPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPLVVTLFCYCRISRRLRRPPHVGRARR
NSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCPLLLALRWGLTIATCLAFVNS
CANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCRAQAANTASAS
W
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcccccacagagccctggagccccagcccggggtcagcgccctgggactactcgggg
ttggacggcctggaggagctggagctgtgtccggccggggacctgccctacggctacgtc
tacatccccgcgctctacctggcggccttcgccgtgggcctgctgggcaacgcctttgtg
gtgtggctgctggccgggcggcggggcccgcggcggctggtggataccttcgtgctgcac
ctggcggcagctgacctgggcttcgtgctcacgctgccgctgtgggccgcggcggcggcg
ctaggcggccgctggccgttcggcgatggcctctgcaagctcagcagcttcgcgctggcg
ggcacgcgctgcgcgggcgcgctgctgctggcgggcatgagcgtggaccgctacctggcc
gtggtgaagctgctcgaggcgaggccactgcgcaccccgcgctgcgcgctggcctcgtgc
tgcggcgtctgggccgtggcgctgctggccggcctgccctccctggtctaccgggggttg
cagcccctgcctgggggccaggacagccagtgcggcgaggagccctcccacgccttccag
ggcctcagcttgctgctgctgctgctgaccttcgtgctgcccctggtcgtcaccctcttc
tgctactgccgcatctcgcgccgcctgcgacggccgccgcacgtgggtcgggcccggagg
aactcgctgcgcatcatcttcgccatcgagagcacgtttgtgggctcctggctgcccttc
agcgccctgcgggccgtcttccacctggcgcgtctgggggcgctgccgctgccgtgcccc
ctgctgctggcgctgcgctggggcctcaccattgccacctgcctggccttcgtcaacagc
tgcgccaacccgctcatctacctcctgctggaccgctcattccgagcccgggcgctggac
ggggcctgcgggcgcaccggccgcctggcgcgaaggatcagctcagcctcctcgctctcc
agggacgacagttccgtgttccgttgccgggcccaggccgcgaacactgcctcggcctcc
tggtag

DBGET integrated database retrieval system