KEGG   Homo sapiens (human): 285093Help
Entry
285093            CDS       T01001                                 

Gene name
RTP5, C2orf85, CXXC11, Z3CXXC5
Definition
(RefSeq) receptor transporter protein 5 (putative)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-3CxxC
Motif
Other DBs
NCBI-GeneID: 285093
NCBI-ProteinID: NP_776182
HGNC: 26585
Ensembl: ENSG00000188011
Vega: OTTHUMG00000151341
Pharos: Q14D33(Tdark)
UniProt: Q14D33
Position
2q37.3
AA seq 572 aa AA seqDB search
MDRAGADMWASTFTLAMAERKPQDVWVLLPEHSLVPGCLDGGGVQYLLVGLSRLQCGHCP
GTWDSAHVHVLFHLWWDRASHRGLVKMRIWGQRCRLCPAPGDCQVRPPGEQPFLSRLVLH
ILQDCYGDGPGPARHPREAYEGCCEACELGVCFLQKAPDPAWSANATKGNFPATAWGGTG
TVSRGKPLSTPGDDLGKGGVVIAIPFSLVGTSNDQVPIAEGPAPPAGASLPVTGSCEALV
IGQGSIFLSGDSVAMPGGKGFPVAIGDPLFHGPGLLGSSIQTFELKGFLFKGRGSLCSPV
GVAQGWGPISLNNGLVPVGKHTPTVFYCVGLSASGEGSLTFPSSLTSIFTNTLSEPTDGP
VATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGS
LALPFPADVQGKDAFTDITEGKEKEGGLVTAGHDAPLEANAEGPITVSEGCITIPFAVFD
VIKRKGGGHVAYGPQGNGCFSQGYYQKRQLRSRFHKARCGCRREEDERPGRACRRPHAEP
YEDFWIWVSMTVCVFWLMCMCRLNPGIYPQQV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggctggggcagacatgtgggccagcaccttcaccctggccatggccgagagg
aagccccaggacgtctgggttctgctacctgagcacagcctggtcccgggatgcctggac
ggcggtggtgtccagtacctgctggtggggctctcgaggctccagtgcggtcactgtccg
gggacctgggactcggcccatgtgcacgtcctcttccacctgtggtgggacagggccagc
caccgggggctggtgaagatgcgcatctggggccagcggtgcaggctgtgccccgcaccc
ggggactgccaggtgaggcccccgggcgagcagcccttcctcagcaggctggtcttgcac
atcctgcaggactgctacggggatggccccggcccagcccggcaccccagggaggcctat
gagggctgctgtgaggcctgtgagctgggggtctgcttcctccagaaggccccagacccc
gcctggagcgccaacgccacaaaaggcaacttccccgccacggcctggggtggcactggc
accgtctccaggggcaaaccgctgtccacccctggcgacgaccttggcaagggtggcgtt
gtcatcgccatccccttctcccttgtgggtaccagcaatgaccaggtgcccatcgctgag
ggccctgccccccctgcgggggcctctctccctgtgactggcagctgtgaggccctggtc
atcggccagggctccatcttcctgtctggggattcagtggccatgcctgggggcaaaggc
ttcccggtggccattggagaccccctcttccacggccccggcctcctcggcagcagcatc
cagaccttcgagctcaagggcttcctcttcaaaggccggggctccctctgcagcccggtt
ggcgtggcccagggctggggccccatctccctcaacaatggcctcgtccctgtggggaaa
cacacgccaaccgtgttctactgtgtgggcctctcggccagcggggagggctccctcacc
ttcccctcctccctcaccagcatcttcaccaacaccctctcggagcccaccgatggccct
gtggccactaaagaggcctccatcaccttccccttcatctttactgatgtcaaggatgcc
gttgctgaggtggctgaaggcaacgggaaggaaggaggcggccagggcctcgtcccagtg
ggtcacgacgccctgccagagaccaatgctggtggcctcccctcccaggtcaagggctcc
cttgccctccccttccctgctgatgtccaaggcaaagatgcctttactgacatcactgaa
ggcaaagagaaggaaggtggcctggtcaccgcgggtcacgacgcccctctggaggccaat
gccgagggccccatcacggttagtgagggctgcatcaccatccccttcgcagtcttcgat
gtcataaagcgcaagggcggtggccacgttgcctacggcccccagggcaatggctgcttc
tcccaaggctattaccagaagaggcagctgaggtccaggttccacaaggcccgctgtggg
tgccgccgggaggaagacgagcgccctggccgtgcctgccgtaggccgcacgccgagccc
tacgaggacttctggatctgggtgtccatgaccgtgtgcgtcttctggctgatgtgcatg
tgtcggctgaaccccgggatctacccgcagcaagtgtga

DBGET integrated database retrieval system