KEGG   Homo sapiens (human): 28514Help
Entry
28514             CDS       T01001                                 

Gene name
DLL1, DELTA1, DL1, Delta
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Module
hsa_M00682  Notch signaling
Network
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    28514 (DLL1)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    28514 (DLL1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    28514 (DLL1)
   05224 Breast cancer
    28514 (DLL1)
  Drug resistance
   01522 Endocrine resistance
    28514 (DLL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF MNNL DSL hEGF EGF_2 EGF_CA EGF_3 ECSCR
Motif
Other DBs
NCBI-GeneID: 28514
NCBI-ProteinID: NP_005609
OMIM: 606582
HGNC: 2908
Ensembl: ENSG00000198719
Vega: OTTHUMG00000016078
Pharos: O00548(Tbio)
UniProt: O00548
Structure
PDB: 

Position
6q27
AA seq 723 aa AA seqDB search
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgaactgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccaccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcgccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggcgcc
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggctgctccgttttctgccgtccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagccgatctgcctgcctggatgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggagccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggattgacgagtgtgaccccagcccttgtaagaacgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcggacggcccttgctttaacgggggtcgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctactccggcttc
aactgtgagaagaaaattgactactgcagctcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggcacctgccgggat
ggcgtgaacgacttctcctgcacctgcccgcctggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccgaggctacgggggtcccaactgccagttcctgctc
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcaccggcccccagcc
gacccctgccggggggagacggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcatcatcggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccagcggtggac
tataacctcgtgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcaacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

DBGET integrated database retrieval system