KEGG   Homo sapiens (human): 285220Help
Entry
285220            CDS       T01001                                 

Gene name
EPHA6, EHK-2, EHK2, EK12, EPA6, HEK12, PRO57066
Definition
(RefSeq) EPH receptor A6
  KO
K05107  Eph receptor A6 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    285220 (EPHA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    285220 (EPHA6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     285220 (EPHA6)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   285220 (EPHA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase EphA2_TM Haspin_kinase Kdo UPF0542 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 285220
NCBI-ProteinID: NP_001265229
OMIM: 600066
HGNC: 19296
Ensembl: ENSG00000080224
Vega: OTTHUMG00000159208
Pharos: Q9UF33(Tchem)
UniProt: Q9UF33
Position
3q11.2
AA seq 398 aa AA seqDB search
MKDSPFQVTKLYWLNEKWDFIASASDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGR
CQWYIKAKMKSEEKRRNHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIE
RVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIR
LEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYM
ENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKV
SDFGLSRVLEDDPEAAYTTTRPTNHNKEQSELVKEDGLESLCEQCESSSGYGTGLVLMWK
RNRRAMGASGQTRKQCDKRDNPPTDLFQTLTLNLCYSA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactctccatttcaagtgacaaaactgtactggcttaatgaaaagtgggacttt
attgcctcagcttctgacatggcagcagaacaaggacagattctcgtgatagccaccgcc
gctgttggcggattcactctcctcgtcatcctcactttattcttcttgatcactgggaga
tgtcagtggtacataaaagccaagatgaagtcagaagagaagagaagaaaccacttacag
aatgggcatttgcgcttcccgggaattaaaacttacattgatccagatacatatgaagac
ccatccctagcagtccatgaatttgcaaaggagattgatccctcaagaattcgtattgag
agagtcattggggcaggtgaatttggagaagtctgtagtgggcgtttgaagacaccaggg
aaaagagagatcccagttgccattaaaactttgaaaggtggccacatggatcggcaaaga
agagattttctaagagaagctagtatcatgggccagtttgaccatccaaacatcattcgc
ctagaaggggttgtcaccaaaagatccttcccggccattggggtggaggcgttttgcccc
agcttcctgagggcagggtttttaaatagcatccaggccccgcatccagtgccaggggga
ggatctttgccccccaggattcctgctggcagaccagtaatgattgtggtggaatatatg
gagaatggatccctagactcctttttgcggaagcatgatggccacttcacagtcatccag
ttggtcggaatgctccgaggcattgcatcaggcatgaagtatctttctgatatgggttat
gttcatcgagacctagcggctcggaatatactggtcaatagcaacttagtatgcaaagtt
tctgattttggtctctccagagtgctggaagatgatccagaagctgcttatacaacaact
agacccacaaatcacaacaaagagcaatcagaactggttaaagaagatggtctggaaagc
ttgtgtgagcagtgcgagtccagctctggttatggtactggactggtcctcatgtggaag
agaaacagaagggccatgggagccagtggccagaccagaaagcaatgtgacaagagagat
aaccctccaacagacctcttccaaactctaacacttaacctctgctattctgcataa

DBGET integrated database retrieval system