KEGG   Homo sapiens (human): 2853Help
Entry
2853              CDS       T01001                                 

Gene name
GPR31, 12-HETER, HETER, HETER1
Definition
(RefSeq) G protein-coupled receptor 31
  KO
K08406  12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2853 (GPR31)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   HETE and oxoETE
    2853 (GPR31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 2853
NCBI-ProteinID: NP_005290
OMIM: 602043
HGNC: 4486
Ensembl: ENSG00000120436
Vega: OTTHUMG00000016013
Pharos: O00270(Tbio)
UniProt: O00270
Position
6q27
AA seq 319 aa AA seqDB search
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALAD
LLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPR
LKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEA
LSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFL
ARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTL
RGKGQAAEPPDFNPRDSYS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccattcccaaactgctcagcccccagcactgtggtggccacagctgtgggtgtcttg
ctggggctggagtgtgggctgggtctgctgggcaacgcggtggcgctgtggaccttcctg
ttccgggtcagggtgtggaagccgtacgctgtctacctgctcaacctggccctggctgac
ctgctgttggctgcgtgcctgcctttcctggccgccttctacctgagcctccaggcttgg
catctgggccgtgtgggctgctgggccctgcacttcctgctggacctcagccgcagcgtg
gggatggccttcctggccgccgtggctttggaccggtacctccgtgtggtccaccctcgg
cttaaggtcaacctgctgtctcctcaggcggccctgggggtctcgggcctcgtctggctc
ctgatggtcgccctcacctgcccgggcttgctcatctctgaggccgcccagaactccacc
aggtgccacagtttctactccagggcagacggctccttcagcatcatctggcaggaagca
ctctcctgccttcagtttgtcctcccctttggcctcatcgtgttctgcaatgcaggcatc
atcagggctctccagaaaagactccgggagcctgagaaacagcccaagcttcagcgggcc
caggcactggtcaccttggtggtggtgctgtttgctctgtgctttctgccctgcttcctg
gccagagtcctgatgcacatcttccagaatctggggagctgcagggccctttgtgcagtg
gctcatacctcggatgtcacgggcagcctcacctacctgcacagtgtgctcaaccccgtg
gtatactgcttctccagccccaccttcaggagctcctatcggagggtcttccacaccctc
cgaggcaaagggcaggcagcagagcccccagatttcaaccccagagactcctattcctga

DBGET integrated database retrieval system