KEGG   Homo sapiens (human): 285368Help
Entry
285368            CDS       T01001                                 

Gene name
PRRT3
Definition
(RefSeq) proline rich transmembrane protein 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 285368
NCBI-ProteinID: NP_997234
HGNC: 26591
Ensembl: ENSG00000163704
Vega: OTTHUMG00000155285
Pharos: Q5FWE3(Tdark)
UniProt: Q5FWE3
Position
3p25.3
AA seq 981 aa AA seqDB search
MASSPWGCVCGLLLLLLPLLGTGPALGRGFPRPLENSEIPMIPGAHPKGSVGSEPQAFDV
FPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQ
GPSSHGWTGPLDSQELLQQEAVAPHPVGHPHLTFIPTTPRRQLRVATVPPSLQHEGQEGQ
WPPRDEGLKAKTKSRVPPTSPSDHQGPPHTLVSHSGTVKRPVLEGQGGFEEHLQEAAQGP
HFTQQDPAAPDVGSVPPVEVVYSQEPGAQPDLALARSLPPAEELPVETPKRAGAEVSWEV
SSPGPPPKQADLPDAKDSPGPQPTDPPASEAPDRPSKPERAAMNGADPISPQRVRGAVEA
PGTPKSLIPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPAPPVQAPSTSRRGLI
RVTTQRALGQPPPPEPTASSMASAPASSPPANATAPPLRWGPLRRVLSFSWELHVYGVGV
LFLLPALLALAALAAAPAGPRLALVAAVLVLVASALRSAYMLTDPYGSQARLGVRGGLVL
YNLPFPLLLTALAALTLLGLGAGLPPPLQNPLLLGAVALVHGVGLLATDLLSTWSVLNLL
TQGLSCAWGAAVALGTLCLCRRRLLDGPRGWDASPGPRLLAVAGALGLLASGLQLAAALW
LYPGPGRVGRFSWAWWGVHFWLRLLELTWALALALAAVAAARPRPPTEHACWAKLMRLAC
PAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGR
GPQGGPGLSRNGVGPAPSLSELDLRPPSPINLSRSIDAALFREHLVRDSVFQRCGLRGLA
SPPPGGALRPRRGSHPKAELDDAGSSLLRGRCRSLSDVRVRGPVPQHVVEAPDGAAAAAS
GSSLDSFSRGSLKISWNPWRHGLSSVDSLPLDELPSTVQLLPAPTPAPDSTAARQGDGQG
EVQPRGKPGESRSASSDTIEL
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagcccatggggctgtgtatgtggccttctgctgttgctgctgccactcctg
gggactggccctgccctggggaggggctttcccaggccacttgaaaactccgaaatccct
atgatccctggagcccaccccaagggctctgtgggctcagagccccaggcctttgacgtg
ttcccggagaaccccagagctgacagtcacaggaactctgatgtccgccacgcccctgct
gaagagatgcctgagaagcctgtagcctctccccttggcccagccctgtacgggcccaaa
gcagcacaaggagctcagagagaacgactcccagtaactgatgacctccagatggctcaa
ggaccaagctcccacggctggacaggacctctggactcacaagagcttctgcagcaagaa
gcagtggctccccacccagtgggccaccctcatctcactttcatccccacaactcccaga
cgtcaactcagggtagccacagttcctccctccctgcagcatgaaggccaagagggacag
tggccacctagagatgagggtctgaaggccaaaactaagagcagggtcccacccacttct
ccctcagaccaccagggcccaccccacacccttgtttcccactcaggtactgtcaagagg
ccagtgctggaaggacagggtgggtttgaggaacacttgcaggaggcagctcaaggtccc
cacttcacccagcaggatccagcagcccctgatgttggctcagtacccccagttgaggtg
gtgtactctcaggagccaggggcccagccagacttggcattggccagaagccttcctcct
gctgaggagctgccggttgagacccccaagagggctggcgctgaggtgtcctgggaagtc
agctccccaggtcccccgcccaagcaggctgaccttcctgacgctaaggattcaccagga
ccccagcccacggatccacccgcctcagaggctcctgatcggccgtctaagccagagaga
gcagcaatgaatggagcagaccccatctccccccagcgggtgagaggagctgtggaggcc
ccaggcacccccaagtctctcatccctggtccctcagaccctggcccagctgtaaaccga
acagagagccccatgggggccctgcagccagatgaagccgaggagtggccggggcgcccc
caaagccatcccccagcacccccagtccaggccccctcgacgtcacgccggggcctcatt
cgagtcaccacgcagcgagccctgggccagcctccccctccggagcccaccgccagctcc
atggcttcagccccagcctccagccccccagccaacgccactgcacccccgctacgctgg
ggcccccttcggcgggtcctgagcttctcctgggagctgcacgtctacggggtgggggta
ctctttctgctgcccgcgttgttggcgctggctgcgctggcagccgccccagcagggccc
cggctggcattggtggccgcggtgctggtgctcgtggcttcggcgctgcgatccgcctac
atgcttaccgacccttacggctcgcaggcgcggctgggcgttcgcgggggcctggtgctc
tacaacctgcccttccccttgctgcttacggcgctggcagccctgactctgctcggcctg
ggcgcggggctgccgccaccgctgcaaaacccactcctgctgggagcagtggcgctggtg
catggtgtagggttgctcgcgacagacctgctgtccacatggtctgtgctcaacctcctg
acgcagggcttgtcgtgcgcctggggcgcggccgtggctctgggcacgctctgcctgtgc
cgtcgccgcctgctggacggcccacggggctgggatgccagcccgggccctcggctgttg
gctgtggcgggcgcgctggggctgctggctagcggcttgcagctggcggctgcgctctgg
ctgtacccgggcccaggccgcgtgggccgcttctcgtgggcctggtggggtgtccacttc
tggctgcgcctcctggagctgacatgggcgctcgccctggcgttggccgcggtggctgcc
gcgagacccaggccgcccacggagcacgcttgctgggctaagctgatgcgtctggcgtgc
ccggcgccgtcaggaaagagcgaggtgccggagcgacccaataactgctatgcagggccc
agcaacgttggtgcaggcagcttggacatcagcaagagcctcatccgcaacccggcggag
agtgggcagctggccacgcccagttcaggcgcctggggctcggctgcgtcgttgggtcgc
ggaccccagggtggcccgggactgtcccgcaacggtgtgggaccggcgccatcgctgagc
gagctggatctgcggccgccatcgcccatcaacctgagccgcagcatcgacgccgcgctc
ttccgcgagcacctagtgcgagacagtgtgttccagcgctgcggcctccgcggcctggcc
tccccgccgcctggaggcgctctgcggccgcgccggggcagccatcccaaagccgagctc
gacgacgctggctcctcgctcctccgcggccgctgcaggtcgctcagcgacgtgcgcgtg
cgcgggccggtcccacagcacgtagtggaagcacccgacggggcagccgctgcggcttct
ggcagctccctcgacagcttctccaggggttcactcaagatcagttggaacccctggcgc
cacgggctgtcatcagtggacagtctgcccctagatgagttgcccagcacggtacagcta
ctgcctgccccgaccccagcccctgattctaccgccgctcggcagggggacggccaggga
gaggtccagccgcgcggcaagcctggggaatcccgcagcgcctccagtgataccatcgag
ctttga

DBGET integrated database retrieval system