KEGG   Homo sapiens (human): 2854
Entry
2854              CDS       T01001                                 

Gene name
GPR32, RVDR1
Definition
(RefSeq) G protein-coupled receptor 32
  KO
K08381  G protein-coupled receptor 32
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2854 (GPR32)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   Chemokine like
    2854 (GPR32)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 2854
NCBI-ProteinID: NP_001497
OMIM: 603195
HGNC: 4487
Ensembl: ENSG00000142511
Vega: OTTHUMG00000183079
Pharos: O75388(Tbio)
UniProt: O75388 H9NIL6
Position
19q13.33
AA seq 356 aa
MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLG
NGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITF
VFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFR
TTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIR
AKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQA
SFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaatggggtctcggaggggaccagaggctgcagtgacaggcaacctggggtcctgaca
cgtgatcgctcttgttccaggaagatgaactcttccggatgcctgtctgaggaggtgggg
tccctccgcccactgactgtggttatcctgtctgcgtccattgtcgtcggagtgctgggc
aatgggctggtgctgtggatgactgtcttccgtatggcacgcacggtctccaccgtctgc
ttcttccacctggcccttgccgatttcatgctctcactgtctctgcccattgccatgtac
tatattgtctccaggcagtggctcctcggagagtgggcctgcaaactctacatcaccttt
gtgttcctcagctactttgccagtaactgcctccttgtcttcatctctgtggaccgttgc
atctctgtcctctaccccgtctgggccctgaaccaccgcactgtgcagcgggcgagctgg
ctggcctttggggtgtggctcctggccgccgccttgtgctctgcgcacctgaaattccgg
acaaccagaaaatggaatggctgtacgcactgctacttggcgttcaactctgacaatgag
actgcccagatttggattgaaggggtcgtggagggacacattatagggaccattggccac
ttcctgctgggcttcctggggcccttagcaatcataggcacctgcgcccacctcatccgg
gccaagctcttgcgggagggctgggtccatgccaaccggcccaagaggctgctgctggtg
ctggtgagcgctttctttatcttctggtccccgtttaacgtggtgctgttggtccatctg
tggcgacgggtgatgctcaaggaaatctaccacccccggatgctgctcatcctccaggct
agctttgccttgggctgtgtcaacagcagcctcaaccccttcctctacgtcttcgttggc
agagatttccaagaaaagtttttccagtctttgacttctgccctggcgagggcgtttgga
gaggaggagtttctgtcatcctgtccccgtggcaacgccccccgggaatga

DBGET integrated database retrieval system