KEGG   Homo sapiens (human): 285440Help
Entry
285440            CDS       T01001                                 

Gene name
CYP4V2, BCD, CYP4AH1
Definition
(RefSeq) cytochrome P450 family 4 subfamily V member 2
  KO
K07427  cytochrome P450 family 4 subfamily V
Organism
hsa  Homo sapiens (human)
Disease
H00825  Familial flecked retina syndrome
Brite
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   285440 (CYP4V2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Alpha_L_fucos
Motif
Other DBs
NCBI-GeneID: 285440
NCBI-ProteinID: NP_997235
OMIM: 608614
HGNC: 23198
Ensembl: ENSG00000145476
Vega: OTTHUMG00000160379
Pharos: Q6ZWL3(Tbio)
UniProt: Q6ZWL3
Position
4q35.1-q35.2
AA seq 525 aa AA seqDB search
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV
GHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDK
SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH
INQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLW
LDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL
DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELD
DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV
IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcggggctctggctggggctcgtgtggcagaagctgctgctgtggggcgcggcgagt
gccctttccctggccggcgccagtctggtcctgagcctgctgcagagggtggcgagctac
gcgcggaaatggcagcagatgcggcccatccccacggtggcccgcgcctacccactggtg
ggccacgcgctgctgatgaagccggacgggcgagaattttttcagcagatcattgagtac
acagaggaataccgccacatgccgctgctgaagctctgggtcgggccagtgcccatggtg
gccctttataatgcagaaaatgtggaggtaattttaactagttcaaagcaaattgacaaa
tcctctatgtacaagtttttagaaccatggcttggcctaggacttcttacaagtactgga
aacaaatggcgctccaggagaaagatgttaacacccactttccattttaccattctggaa
gatttcttagatatcatgaatgaacaagcaaatatattggttaagaaacttgaaaaacac
attaaccaagaagcatttaactgctttttttacatcactctttgtgccttagatatcatc
tgtgaaacagctatggggaagaatattggtgctcaaagtaatgatgattccgagtatgtc
cgtgcagtttatagaatgagtgagatgatatttcgaagaataaagatgccctggctttgg
cttgatctctggtaccttatgtttaaagaaggatgggaacacaaaaagagccttcagatc
ctacatacttttaccaacagtgtcatcgctgaacgggccaatgaaatgaacgccaatgaa
gactgtagaggtgatggcaggggctctgccccctccaaaaataaacgcagggcctttctt
gacttgcttttaagtgtgactgatgacgaagggaacaggctaagtcatgaagatattcga
gaagaagttgacaccttcatgtttgaggggcacgatacaactgcagctgcaataaactgg
tccttatacctgttgggttctaacccagaagtccagaaaaaagtggatcatgaattggat
gacgtgtttgggaagtctgaccgtcccgctacagtagaagacctgaagaaacttcggtat
ctggaatgtgttattaaggagacccttcgcctttttccttctgttcctttatttgcccgt
agtgttagtgaagattgtgaagtggcaggttacagagttctaaaaggcactgaagccgtc
atcattccctatgcattgcacagagatccgagatacttccccaaccccgaggagttccag
cctgagcggttcttccccgagaatgcacaagggcgccatccatatgcctacgtgcccttc
tctgctggccccaggaactgtataggtcaaaagtttgctgtgatggaagaaaagaccatt
ctttcgtgcatcctgaggcacttttggatagaatccaaccagaaaagagaagagcttggt
ctagaaggacagttgattcttcgtccaagtaatggcatctggatcaagttgaagaggaga
aatgcagatgaacgctaa

DBGET integrated database retrieval system