KEGG   Homo sapiens (human): 285498
Entry
285498            CDS       T01001                                 

Gene name
RNF212, ZHP3
Definition
(RefSeq) ring finger protein 212
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-RING_5 Prok-RING_4 Fib_alpha zf-RING_UBOX
Other DBs
NCBI-GeneID: 285498
NCBI-ProteinID: NP_001124506
OMIM: 612041
HGNC: 27729
Ensembl: ENSG00000178222
Vega: OTTHUMG00000118997
Pharos: Q495C1(Tdark)
UniProt: Q495C1
Position
4p16.3
AA seq 297 aa
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDA
DIQAFFMSIDSLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQ
SMRSSQQTAFSTIKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARI
SMISPPQDGRMGPHLTASFCFIPWLTLSKPPVPGECVISRGSPCFCIDVCPHWLLLLAFS
SGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTPAVSVVFPLCQFERKKSF
NT seq 894 nt   +upstreamnt  +downstreamnt
atggccaactgggtgttctgtaatcgctgcttccagccgccccacaggacgtcgtgcttc
agcctcaccaactgcgggcacgtgtactgcgacgcctgcctcggcaaaggtaaaaagaat
gaatgcttgatttgtaaagctccttgtcgtacagttttgctttcaaagcataccgacgca
gatatccaggcattcttcatgagcatagacagtctgtgtaagaagtactccagggaaacc
tcccagattttagaatttcaagaaaaacacaggaagagattgttagccttctatagagaa
aagatttctaggttggaagaatcccttaggaagtcagtgctgcagatagaacaactacaa
agtatgagatcatcacaacaaacagctttcagcacaataaaaagttcagtttcaacaaaa
ccacacggatgcctgctgccacctcactcatcagcccccgacagactggagtcgatggaa
gttgatctctctccttctccgattagaaaatctgagatagcagccggccctgcgagaatc
tccatgattagtccacctcaagatggacgaatggggccacatctaacagcttctttctgt
ttcatcccatggttgaccttgtctaagccccctgtgcccggagagtgtgtcatttccaga
ggttcaccatgtttctgcatagacgtctgtcctcactggctgctcctcctagcgttcagt
tctggaaggcacggggaactcaccaactctaaaacacttccaatatatgctgaggtacaa
agggccgtcttgtttccgttccagcaggctgagggcaccctggacacgttcagaacaccc
gctgtgtctgttgtgtttcctctttgccaatttgaaaggaaaaagtcattttga

DBGET integrated database retrieval system