KEGG   Homo sapiens (human): 285513
Entry
285513            CDS       T01001                                 

Gene name
GPRIN3, GRIN3
Definition
(RefSeq) GPRIN family member 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GRIN_C
Other DBs
NCBI-GeneID: 285513
NCBI-ProteinID: NP_938022
OMIM: 611241
HGNC: 27733
Ensembl: ENSG00000185477
Vega: OTTHUMG00000161044
Pharos: Q6ZVF9(Tdark)
UniProt: Q6ZVF9
Position
4q22.1
AA seq 776 aa
MGTVPDPLRSAKTSLIAASGKEDDLGEPQAASPRHRPALLCKNANGFSGAPAEPDLSPRA
AAEALMQVCEHETTQPDMSSPGVFNEVQKAPATFNSPGNPQLPGSSQPAASAPSSAAGRD
LIHTPLTMPANQHTCQSIPGDQPNAITSSMPEDSLMRSQRTSNREQPEKPSCPVGGVLSS
SKDQVSCEFPSPETIQGTVQTPVTAARVVSHSSSPVGGPEGERQGAICDSEMRSCKPLTR
ESGCSENKQPSVTASGPQGTTSVTPQPTPLTSEPSACPPGPEKVPLPAQRQMSRFKEAST
MTNQAESEIKEVPSRAWQDAEVQAVASVESRSVSTSPSILTAFLKESRAPEHFEQEQLRV
ICHSSGSHTLELSDSTLAPQESSQCPGIMPQVHIQAAAAESTAFQRENKLASLPGGVLKT
SSINLVSSNAQHTCKEDGRLAGMTPVREESTAKKLAGTNSSSLKATAIDQISISACSQAE
TSYGLGKFETRPSEFAEKTTNGHKTDPDCKLSDSCGSISKADHSGSLDPTNKGDAREKKP
ASPQVVKEKESTGTDTSDAKTLLLNPKSQESGGTESAANPTPSPIRKNQESTLEENRQTK
TATSLSLPSDPMGDSSPGSGKKTPSRSVKASPRRPSRVSEFLKEQKLNVTAAAAQVGLTP
GDKKKQLGADSKLQLKQSKRVRDVVWDEQGMTWEVYGASLDAESLGIAIQNHLQRQIREH
EKLIKTQNSQTRRSISSDTSSNKKLRGRQHSVFQSMLQNFRRPNCCVRPAPSSVLD
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggggactgtacctgaccctctgagatcagctaaaacttccctgattgcagcttccgga
aaagaagacgatctaggagagccacaggctgcctcacctcggcatcgaccagctctcctg
tgtaagaatgccaatggcttttcaggtgcccctgcagaaccagacctcagccccagggca
gctgccgaagccctgatgcaggtttgtgagcatgagaccacccaaccagatatgtcttct
cctggtgtgttcaatgaagtgcagaaagcacctgccacattcaactctcccggcaatccc
cagctgccagggagcagccagcccgcagcatcagccccgagttctgcagcaggaagggat
cttatacacacaccattgacaatgcccgccaatcagcacacctgccagtccatcccaggt
gatcagcccaatgccatcacctcatccatgcctgaagattccctgatgagatcacagaga
acctcaaatagagagcaacctgagaaaccaagttgtcctgtgggaggcgtcctcagtagc
agcaaagatcaggtgtcctgtgagtttccttctccagaaacaatccagggaacagtgcag
actccagtgacagcagccagggtggtcagtcactcatcctctcctgtaggtggacctgaa
ggggaaaggcagggagccatctgtgactctgaaatgaggtcctgtaaacctctaactaga
gaatctggatgttcagagaacaagcagccctctgtcactgcctcgggcccccaaggcaca
acttctgtgacacctcaaccaacccccctcactagcgaaccttcggcatgtcccccaggt
ccagagaaggtgccgctgccagcacagcgtcagatgtcaaggttcaaagaagccagtacg
atgaccaaccaagctgaaagtgaaatcaaggaagttcccagcagggcttggcaagatgcg
gaggtgcaggcagtggcgagtgtcgagagcagatccgtctccaccagccccagtatcctc
actgcatttctgaaggaaagccgtgctcctgagcattttgaacaagagcagctgcgtgtc
atttgccacagcagtgggagccacacactggagctctctgacagcacgctagccccccag
gagtccagccagtgccctggcatcatgccacaggtgcacattcaggcagctgcagctgag
tctacagctttccaacgggaaaataaacttgcgagcctaccaggtggggtccttaaaacc
tcatcaatcaatttggtctccagtaatgcccagcatacgtgtaaagaagatgggaggtta
gcaggaatgactccagtgagggaagagtcaactgctaaaaagctcgcaggtactaattct
agctccctgaaagctaccgccattgaccagatttctatcagtgcatgcagtcaagctgaa
acaagttatggattggggaaatttgaaaccaggccatctgagtttgcagagaaaacgaca
aacggccacaaaacagacccagattgcaaactatctgactcttgtggctctatcagcaaa
gctgatcattctgggagcttggatcccactaataaaggagatgcaagggaaaagaagcct
gcatctcctcaggtagtaaaagaaaaagagtctactggcactgatacctcggatgccaaa
accctactgctcaatcctaaatcccaagaaagtggaggcacagaatcagctgctaatcct
acaccctccccaattaggaagaaccaggagagcaccttagaagaaaacagacagaccaag
acagccaccagcctgagcctgccatctgatcccatgggtgactccagcccaggttctggc
aagaagaccccatctcgctccgtcaaagccagcccacgcaggcccagccgcgtcagcgag
ttcctcaaggagcaaaagttaaatgtgacagcagctgctgctcaggtaggactcactcca
ggagataagaaaaagcagcttggcgcagactccaagctccagctgaaacagtccaagcgt
gtcagggacgtcgtgtgggatgagcagggaatgacctgggaagtgtatggtgcatccttg
gacgcagagtccctgggaatcgcgatccagaaccatttgcaaagacaaatcagggaacat
gagaaattaatcaaaactcaaaatagccagacccggagatccatttcctcagatacttct
tcaaataagaagctcagaggaaggcagcacagtgttttccagtccatgctgcagaacttc
cgacgccccaactgctgcgtccgtcctgccccgtcttctgtgttagattga

DBGET integrated database retrieval system