KEGG   Homo sapiens (human): 285521
Entry
285521            CDS       T01001                                 
Symbol
COX18, COX18HS
Name
(RefSeq) cytochrome c oxidase assembly factor COX18
  KO
K17797  mitochondrial inner membrane protein COX18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    285521 (COX18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    285521 (COX18)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    285521 (COX18)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    285521 (COX18)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   285521 (COX18)
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-GeneID: 285521
NCBI-ProteinID: NP_776188
OMIM: 610428
HGNC: 26801
Ensembl: ENSG00000163626
Pharos: Q8N8Q8(Tdark)
UniProt: Q8N8Q8
Position
4:complement(73052362..73069759)
AA seq 333 aa
MLCRLGGRWLRPLPALQLWARDLPLAPVPTSGAKRPTLPVWAVAPVSAVHANGWYEALAA
SSPVRVAEEVLLGVHAATGLPWWGSILLSTVALRGAVTLPLAAYQHYILAKVENLQPEIK
TIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNCHPFKATVLVWIQLPM
WIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVE
ICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPG
FRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgctgtgccggctcggcggtcggtggctgcggccgctccctgccctgcagctttgggct
agggacctgccgcttgcgccggttcctacgagcggcgccaagcgccccactctcccagtg
tgggcagtggcaccagtctctgcagtacatgcgaacggctggtacgaggccctggccgcg
tcttcgccggtgcgggttgcggaggaagtactgctcggcgtgcacgccgccacgggcctg
ccctggtggggcagcattctgctctccaccgtggccttacggggtgctgtcacgctgcct
ttggcagcctaccagcactacatcctggccaaggtggaaaatttgcagccagaaataaaa
actattgccaggcatcttaaccaagaagttgcagttcgtgcaaatcagttggggtggtcc
aaaagagatgccaggctcacttatctaaagaatatgaggaggctaatttcagagctatat
gtgcgagataactgccaccctttcaaagccactgtgttggtttggattcagcttccaatg
tggatcttcatgtcttttgctctccggaatttaagcacgggggcagcacattcagaaggt
ttttctgttcaggaacagttagctactggtggaattctgtggtttcctgacctcactgca
cccgactccacttggattctgcctatctctgttggcgtcatcaatttgttaatagtggag
atttgtgctctacaaaaaattggaatgtctcgttttcagacgtatattacgtactttgtc
cgtgcaatgtcggtgttgatgataccaattgctgcaacggtaccctcatcaattgttctc
tactggttatgctccagcttcgtgggcctttcacagaatttgctgctgcgttctcctgga
tttcgccaactttgccgaataccatcgaccaagtcagattcagaaactccttataaagac
atatttgctgcctttaataccaagttcatttcaagaaaatga

DBGET integrated database retrieval system