KEGG   Homo sapiens (human): 285527Help
Entry
285527            CDS       T01001                                 

Gene name
FRYL, AF4p12, KIAA0826, MOR2
Definition
(RefSeq) FRY like transcription coactivator
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MOR2-PAG1_N MOR2-PAG1_C MOR2-PAG1_mid
Motif
Other DBs
NCBI-GeneID: 285527
NCBI-ProteinID: NP_055845
HGNC: 29127
Ensembl: ENSG00000075539
Vega: OTTHUMG00000160608
Pharos: O94915(Tdark)
UniProt: O94915 Q6ZR29 B3KXG5
Position
4p11
AA seq 3013 aa AA seqDB search
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLI
SSMSSVAEHCLPSLLRTLFDWYRRQNGTEDESYEYRPRSSTKSKGDEQQRERDYLLERRD
LAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFE
ASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTT
FELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLD
FAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSLQQKDGEPPMPTTGVILPSG
NTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTL
QALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNQD
TQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQF
DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQLLSPQV
DINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIK
EALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHFLNNTLLEYVD
LTRQLLEAENEKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHW
AGPFSIMFTPLDRYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNI
LDSLDKKVHQLGCEAVTLLLELNPDQSNLMYWAVDRCYTGSGRVAAGCFKAIANVFQNRD
YQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMFRYAHKLEVQRTDGVLSQLSPL
PHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVD
LKPLPTARRHDEDEDDSLKDRELMVTSRRWLRGEGWGSPQATAMVLNNLMYMTAKYGDEL
AWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLE
ELVSELQLTDPVSSGVTHMDNPPYYRITSSYKIPSVTSGTTSSSNTMVAPTDGNPDNKPI
KENIEESYVHLDIYSGLNSHLNRQHHRLESRYSSSSGGSYEEEKSDSMPLYSNWRLKVME
HNQGEPLPFPPAGGCWSPLVDYVPETSSPGLPLHRCNIAVILLTDLIIDHSVKVEWGSYL
HLLLHAIFIGFDHCHPEVYEHCKRLLLHLLIVMGPNSNIRTVASVLLRNKEFNEPRVLTV
KQVAHLDYNFTAGINDFIPDYQPSPMTDSGLSSSSTSSSISLGNNSAAISHLHTTILNEV
DISVEQDGKVKTLMEFITSRKRGPLWNHEDVSAKNPSIKSAEQLTTFLKHVVSVFKQSSS
EGIHLEHHLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTATTLSDVLSRLVETVGDPG
EDAQGFVIELLLTLESAIDTLAETMKHYDLLSALSQTSYHDPIMGNKYAANRKSTGQLNL
STSPINSSSYLGYNSNARSNSLRLSLIGDRRGDRRRSNTLDIMDGRINHSSSLARTRSLS
SLREKGMYDVQSTTEPTNLMATIFWIAASLLESDYEYEYLLALRLLNKLLIHLPLDKSES
REKIENVQSKLKWTNFPGLQQLFLKGFTSASTQEMTVHLLSKLISVSKHTLVDPSQLSGF
PLNILCLLPHLIQHFDSPTQFCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDC
SNWINVVCRYLHDSFSDTTFNLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLSAAPAK
QFNLEIIKIIGKYVQSPYWKEALNILKLVVSRSASLVVPSDIPKTYGGDTGSPEISFTKI
FNNVSKELPGKTLDFHFDISETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNS
NALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLIS
TTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDK
GDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPD
HPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDE
GSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEAD
FSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDG
SSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVF
VDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDA
QQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILK
EAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCE
DDPVQTLLHIYFHHQTLGQTGSFAVIGSNLDMSEANYKLMELNLEIRESLRMVQSYQLLA
QAKPMGNMVSTGF
NT seq 9042 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacattacgattgacccagatgtcaaacctggtgaatatgtcatcaagagcctc
tttgcagaatttgctgttcaagctgaaaagaaaattgaagttgtaatggccgaacccttg
gagaagctattgtccagatctcttcagaggggtgaagatcttcagtttgatcagttgata
agctctatgagctcagtagcagagcactgtctcccttccttacttcgcaccttgtttgac
tggtacagacgccaaaatggaacggaagatgaatcttatgaatataggcctcggtctagc
acaaagtctaagggggatgaacagcaacgtgaaagagattatcttcttgaaaggagggac
ttagcagtagacttcattttttgtttagttttagttgaagttctaaagcagattcctgtt
catcctgtacccgatcccttagttcatgaagttctaaacttagcttttaagcactttaaa
cataaggaaggatattcaggaaccaacactgggaatgtgcatattattgctgatttatat
gcagaggtgataggggttcttgcccaatcaaagtttcaggctgtaaggaagaagtttgtg
acagaattaaaagaactgcgacaaaaggaacaaagcccacatgtggtacaaagtgtcatc
agcttaataatgggaatgaaattttttcgagtaaaaatgtatcctgtagaagattttgaa
gcatcatttcaatttatgcaggaatgtgctcagtatttcttagaagtgaaagataaagat
ataaaacatgcacttgctggtttatttgtggagattcttatccctgtagctgctgctgtt
aaaaatgaagtgaatgttccctgtttgaaaaattttgtggagatgctttatcagactact
tttgaactgagctcgagaaagaagcattcattggctttatatccactaattacctgcctt
ttatgtgtcagtcagaaacaattttttttaaataactggcatattttcctacagaactgt
ttgtcacatttaaagaataaagatccgaaaatgtctcgagttgcactggaatctttgtat
agattattgtgggtttatgtaattagaataaaatgtgaaagcaacactgtaactcaaagt
cgtcttatgagcatagtgtcagcactttttccaaaaggctcacgaagtgtggttcctcgt
gacacacctctcaatatatttgtgaagattattcagttcattgctcaggaacgcttggat
tttgcaatgaaagaaataatatttgatcttctcagtgttggaaaatctactaaaactttc
accattaatccagagagaatgaacataggtctcagagtcttccttgtaatagcagacagt
ttgcagcagaaagatggtgaaccacccatgccaacaacaggagttattcttccctcagga
aatactcttcgtgtaaagaaaatatttctcaataaaaccttgacagatgaagaagcaaaa
gtcataggaatgtcagtttactatcctcaagtaagaaaagcattagatagcatcctcaga
catttggacaaagaagttgggagaccaatgtgtatgaccagtgtgcagatgtctaataag
gagcctgaagacatgattacgggggaaagaaaacccaagattgatttgtttagaacttgt
attgctgcgattccaaggttgattcctgacggtatgagcagaactgacctgattgaattg
ttagcaaggctcacaattcatatggatgaagaactgcgtgctctggctttcaatactctg
caggcactaatgcttgattttccagattggcgggaggatgttctttcaggatttgtttat
tttattgttcgtgaagtgactgatgtccatcccacacttcttgataatgccgtaaagatg
ttggtacaattaataaatcagtggaaacaagcagcccaaatgcataataaaaaccaggac
actcagcatggtgtagctaatggagcttctcatccccctcctctggaaaggagcccatat
tccaatgtattccatgtggttgaaggctttgcgcttgtcattctctgtagcagtcgacct
gccactaggagactagccgtcagtgtccttagagaaatacgggctttatttgcacttctg
gaaatacctaagggtgatgatgaattagccatagatgtgatggacaggctaagcccatcc
attcttgagagcttcatacatctcactggggctgatcagactactttgctctattgccct
agctcgatagatttacaaactttagcagaatggaactcttctcctattagccaccagttt
gatgtgattagtccatcacatatatggatatttgcacatgtgacccaaggccaagaccca
tggattataagtctctccagttttttaaagcaagaaaatcttcctaaacactgctctaca
gctgtgagctatgcttggatgtttgcatacacaagacttcagttgttgtcccctcaggtc
gatataaatagccccatcaatgctaagaaagtaaataccaccacaagcagtgactcatac
attggcctgtggagaaactatctgatcctttgctgcagtgcagcaacatcgtcatcttcc
acatctgcaggttctgtgagatgttctcctcctgagacgctggcgtctaccccagatagc
ggctatagcattgattctaaaattattggcatcccatccccttcatccttgtttaagcac
atagttccaatgatgcgttctgagagcatggaaatcacagaatcccttgttctaggtctt
ggcaggaccaacccaggagcttttagggaactaatagaggaattacatcccataattaaa
gaagcactcgaaagaaggccagagaatatgaaacggcgcaggcgtcgagacattttacga
gtacaactggtacgaatatttgaactgctggcagatgctggtgtcattagtcacagtgca
agtggtggccttgataatgaaacacattttctcaacaacactttattggaatatgtagat
ttaactagacaactcctggaagcagaaaatgaaaaagactctgacacactgaaggatata
cgatgccattttagtgccttagtggcgaatattattcagaatgttccagtgcaccagaga
agaagtatttttcctcaacagagccttcgtcacagtctatttatgctgttcagtcactgg
gcaggtccttttagcatcatgtttacgcccttggacagatacagtgatagaaatatgcaa
attaatagacatcaatactgtgcgttaaaggctatgtctgctgtactgtgttgtggccct
gttgcagataatgtaggactttcatcagatggctatttgtacaaatggttggataacatt
ttggattctctggacaaaaaggttcaccagctgggctgtgaagcagttacgttgttactg
gagctgaaccctgatcagagcaacctgatgtactgggctgtggaccgctgctacacgggc
tccgggagggtggcggccggctgctttaaagccattgctaatgttttccagaacagggat
tatcaatgtgacacagtgatgcttctaaatctgatactgtttaaagcagctgattcttct
agaagtatctatgaagttgctatgcaacttttacagattctggaaccgaagatgtttcgc
tatgctcacaaattggaggttcagagaacagatggagtactcagccagctgtctcctcta
ccacatctctattctgtttcatattatcagttgtccgaggaactagcaagggcgtatcct
gagctaactctcgccatattctcagagataagccagagaatccagacagctcaccctgct
gggcggcaggtgatgctgcactacctgctaccatggatgaacaacatcgagctggtggac
ttaaaacctctccccacagcaaggcgacatgatgaagatgaagatgattccttaaaagac
cgagaacttatggtgactagtaggcgctggttacggggagaaggatggggatctccacaa
gccactgcaatggttttgaacaatctgatgtatatgacagcaaagtatggcgatgaactg
gcctggtcggaggtggagaatgtgtggaccacacttgcagatggctggcccaaaaacctg
aaaataattttgcactttttgatcagcatttgtggggtgaatagcgaaccaagcctcttg
ccttacgtgaagaaggtcattgtatatttaggtagagataaaacaatgcagttgctagaa
gagctggtgagtgagcttcagctgaccgatcctgtcagttcaggggtcactcacatggat
aatcccccgtattatcgcatcacttccagctataaaatcccttctgtcacctcaggaact
acttccagtagcaatacaatggtagctcccacagatggcaatcctgataataagcccatt
aaagagaatattgaagagagctatgtgcacctggacatttacagtggactaaacagtcat
ttgaatcggcaacatcacagactagaatcccgatacagtagcagctctggaggatcttat
gaagaagaaaaaagtgattcaatgccactttattctaattggcgactgaaagtgatggag
cataaccaaggagagccactgcccttcccaccagctggaggctgctggtcaccactggtg
gattacgtgcctgaaacgtcatcacctggattacctcttcacaggtgtaacatagcagtg
atccttttgactgatctcatcattgatcatagtgtgaaggtggaatggggaagctacctc
catcttcttcttcatgcaatttttatagggtttgaccactgccaccctgaggtgtatgaa
cattgtaaacgcctgcttctgcacttattaatagtaatgggacccaatagtaacatccga
actgttgcttctgtccttctcaggaacaaggagtttaatgagcccagggtgcttacagtc
aaacaagttgcacacttagattataatttcacagcaggcattaacgattttatacctgat
taccagccctcccctatgactgactcagggcttagctcaagttctacctcttctagtatc
agcttaggaaataacagtgctgccatttcacatctgcacaccactatcctcaatgaggtt
gacatctcagtggagcaggatggaaaagtcaaaaccctcatggaattcattacctcaaga
aaaagagggcccctttggaaccatgaggatgtttctgccaagaatcctagcataaagagt
gctgaacagttaactacatttttgaaacatgtggtttctgtttttaagcagtcaagctca
gaaggaattcatctggaacatcatcttagtgaagttgctctgcaaacagcactttcctgt
tcttctcgacactatgctgggagatcctttcagattttcagggccctaaagcagcctctc
actgcaactacactttctgatgttctctccagacttgtagaaactgtaggggatccagga
gaagatgcacagggatttgtgattgagcttcttctcacattggaatctgcaattgatact
ttggctgaaaccatgaagcattatgatcttctttctgccctttctcaaacctcatatcat
gatcctataatgggaaacaagtatgcagctaacaggaaaagcactggacaactcaatcta
agcacaagtcccattaatagtagcagttatttgggatataacagtaatgcaagaagtaac
tctttgagattaagtttgattggtgaccgacgaggtgaccggcggcggagtaacacactg
gatataatggatggacggataaaccatagcagtagtttagcaaggactagaagcctttcc
tctctaagagagaaaggaatgtatgacgtgcagtccactactgagcctaccaacttgatg
gccaccattttttggatagcagcatctttattagaatcagattatgaatatgaatacctc
ctggctctcaggcttctcaacaaactgcttatccatttgcctttggataaatcagagagt
cgagagaagattgaaaatgtacaaagcaaattgaaatggactaattttccaggacttcag
cagctcttccttaagggttttacctcagcatctacacaagaaatgaccgtgcacctcctc
agtaaactcatttctgtctccaaacatacattggtggatccttcccaattgtcaggcttt
cctcttaacatcctttgcttattgcctcacttaatccagcattttgacagcccaactcag
ttttgcaaagaaacagctagtcgaatagcaaaggtttgtgcagaagaaaaatgcccaaca
cttgtcaatctggcacacatgatgagtttgtacagtacacacacgtattccagagactgt
tctaactggatcaatgtcgtgtgcagatacctgcatgactccttctcagatacaacattt
aatcttgtgacttatcttgcagagctgttagagaaaggattgtccagtatgcagcaatca
ttactacagattatttatagtctattgagtcatattgacctgtctgcagccccagccaag
cagtttaatctggagatcataaagattattggcaaatatgtacagagtccttactggaag
gaagcccttaacatattaaagctggtggtgtcacgctctgcgagtcttgtcgtacccagt
gatatccccaagacctatggaggagatacaggttctcctgaaatatccttcactaaaatt
tttaataatgtttctaaggagttgcctgggaagaccttagattttcattttgatatatct
gagacaccaattattggaaacaaatatggtgatcagcacagtgcggctggaagaaatggg
aaaccaaaagttattgctgtcactagaagtacttcctcaacttcttctggttctaattct
aatgccttggttcctgttagttggaaaaggccacagttatcacagcgaagaacaagagaa
aagctaatgaatgtgctttctctctgtggtccagaatctggcctcccaaagaacccatca
gttgtattttcttctaatgaggatttggaagtcggtgaccaacagactagcctaatttct
acaacagaagacataaatcaagaggaagaagtagctgtggaagataatagcagtgaacaa
cagtttggtgtttttaaggattttgactttttagatgttgaattggaagatgcagagggt
gaaagtatggacaatttcaactggggagttcgcaggcgctcactggacagtattgacaaa
ggggacactccatccctccaggagtaccagtgctctagtagcacccccagcctgaacctc
accaatcaggaggatacagatgagtcctcggaagaagaagcggcacttacagcaagccag
atactctcacgcacacagatgttaaacagtgattctgccactgatgaaacaataccagac
catcctgacttacttctccagtctgaagattccactggcagcatcacaacagaggaagtg
cttcaaatcagggatgagaccccaactttggaggcttctctagataatgctaacagccgg
ctgcctgaggatacaacttcagtattaaaggaggaacatgttacaacctttgaagatgaa
ggatcctatataattcaagaacagcaggaatctcttgtgtgtcaaggaattcttgattta
gaagaaactgaaatgccagagcctctagctcctgaaagttaccccgagtcagtctgtgaa
gaggatgttaccttagctctgaaagagctagatgaaagatgtgaagaagaagaagcggat
ttctccggactgtctagtcaagatgaagaagagcaagatggttttccagaagtacagacg
tcgcctctgccgtcaccatttctttctgccatcatagccgcctttcagcccgtggcatat
gatgatgaagaggaagcctggcgctgccacgtcaatcagatgctgtctgacaccgacggg
tcctctgcagtgtttacttttcatgtgttttctaggctgtttcagacaattcaaagaaag
tttggagaaataactaatgaggcagtcagctttcttggtgatagtctgcaacgcattggt
accaaatttaaaagttccttggaagtgatgatgctgtgttcagaatgcccaacagtcttt
gtggatgctgaaacactgatgtcatgtggtttgctggaaacactcaagtttggtgttttg
gagttgcaagaacacctggatacatacaatgtgaaaagagaagccgctgagcagtggcta
gatgattgtaagaggacatttggtgccaaagaagacatgtataggataaacacagatgca
caacaaatggaaatactagcagaattggagctctgccgaagattatacaaattgcatttt
caattgctgcttctgttccaggcctactgtaaacttatcaaccaagtaaatacgataaaa
aatgaagcagaggtcatcaacatgtcagaggaacttgcccaactggaaagtatcctcaaa
gaagctgagtccgcttccgaaaacgaagaaattgacatttccaaagctgcacaaactact
atagaaactgccattcattctttaattgaaactttgaaaaataaagaatttatatcagct
gtagcacaagtcaaagctttcagatctctctggcccagtgatatctttggcagttgtgaa
gatgaccctgtacagacactgttacatatatatttccatcatcagacgctgggccagaca
ggaagctttgcagttataggctctaacctggacatgtcagaagccaactacaaactgatg
gaacttaatctggaaataagagagtctctacgcatggtgcaatcataccaacttctagca
caggccaaaccaatgggaaatatggtgagcactggattctga

DBGET integrated database retrieval system