KEGG   Homo sapiens (human): 285641Help
Entry
285641            CDS       T01001                                 

Gene name
SLC36A3, PAT3, TRAMD2, tramdorin2
Definition
(RefSeq) solute carrier family 36 member 3
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    285641 (SLC36A3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    285641 (SLC36A3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    285641 (SLC36A3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    285641 (SLC36A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   285641 (SLC36A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans Cytochrom_B561
Motif
Other DBs
NCBI-GeneID: 285641
NCBI-ProteinID: NP_861439
OMIM: 608332
HGNC: 19659
Ensembl: ENSG00000186334
Vega: OTTHUMG00000130128
Pharos: Q495N2(Tdark)
UniProt: Q495N2
Position
5q33.1
AA seq 470 aa AA seqDB search
MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIHLLKCNIGTGL
LGLPLAIKNAGLLVGPVSLLAIGVLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLE
TCPNTWLRAHAVWGRYTVSFLLVITQLGFCSVYFMFMADNLQQMVEKAHVTSNICQPREI
LTLTPILDIRFYMLIILPFLILLVFIQNLKVLSVFSTLANITTLGSMALIFEYIMEGIPY
PSNLPLMANWKTFLLFFGTAIFTFEGVGMVLPLKNQMKHPQQFSFVLYLGMSIVIILYIL
LGTLGYMKFGSDTQASITLNLPNCWLYQSVKLMYSIGIFFTYALQFHVPAEIIIPFAISQ
VSESWALFVDLSVRSALVCLTCVSAILIPRLDLVISLVGSVSSSALALIIPALLEIVIFY
SEDMSCVTIAKDIMISIVGLLGCIFGTYQALYELPQPISHSMANSTGVHA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgcttggaagggactacaacagtgagctgaactccttggacaacggacctcag
tcaccctcagagagcagcagtagcattacttcagagaatgtccatcctgctggagaagct
ggactatcgatgatgcaaactttgatccacttgttgaaatgcaacattggcacagggctc
ctggggcttcccctggccataaagaatgccggcttgttggtcggtcctgtcagccttctg
gccatcggggtcctcaccgtgcactgcatggtcatcctgttgaactgtgctcaacacctc
agccagagactgcagaagacttttgtgaactatggagaggccacgatgtacggccttgaa
acctgcccgaacacctggctgagggcccatgcagtgtggggaaggtacactgtcagcttc
ttattagtcatcacccagctgggcttctgcagtgtttattttatgtttatggcagacaat
ttacaacagatggtggaaaaagcccacgtgacctccaacatctgccagcccagggagatt
ctgacgctgacccccatcctggacattcgtttctacatgctgataatcctgcccttcctg
atcctgttggtgtttatccagaacctcaaggtgctgtccgtcttctcgacattggccaac
atcaccacccttgggagcatggctctgatctttgagtatatcatggaggggattccatat
cccagcaacctacccttgatggcaaactggaagaccttcttgctgttctttggtacagcc
atcttcacatttgaaggcgtcggtatggttctgcctctcaaaaaccagatgaagcatcca
cagcagttttcttttgttctgtacttggggatgtccattgtcatcatcctctatatctta
ctggggacactgggctacatgaagtttgggtcagacacccaggccagcatcaccctcaac
ttgcccaattgctggttgtaccagtcagtcaagctgatgtactctatcggcatcttcttc
acctatgccctccagttccacgtcccagctgagatcatcatcccgtttgccatctcccaa
gtgtcagagagctgggcactgtttgtagacctgtctgtccgctcagccttggtctgtcta
acctgtgtctcagccatcctcatcccccgcctggacttggtcatctccctggtaggctcc
gtgagcagcagcgccctggctctcatcatcccagccctcctggagatcgtcatcttttac
tctgaggacatgagctgtgtcaccattgccaaggacatcatgattagcatcgtgggcctt
ttagggtgtatatttgggacataccaagccctctatgagttgccccaacccatcagccat
tccatggccaactccacaggtgtccatgcataa

DBGET integrated database retrieval system