KEGG   Homo sapiens (human): 285704
Entry
285704            CDS       T01001                                 

Gene name
RGMB, DRAGON
Definition
(RefSeq) repulsive guidance molecule BMP co-receptor b
  KO
K06847  RGM domain family member B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    285704 (RGMB)
SSDB
Motif
Pfam: RGM_C RGM_N C8
Other DBs
NCBI-GeneID: 285704
NCBI-ProteinID: NP_001012779
OMIM: 612687
HGNC: 26896
Ensembl: ENSG00000174136
Vega: OTTHUMG00000162745
Pharos: Q6NW40(Tbio)
UniProt: Q6NW40 J3KNF6
Structure
PDB: 

Position
5q15
AA seq 478 aa
MIRKKRKRSAPPGPCRSHGPRPATAPAPPPSPEPTRPAWTGMGLRAAPSSAAAAAAEVEQ
RRSPGLCPPPLELLLLLLFSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHLNSAVDGFDS
EFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPC
NYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQV
TNVPVVPGSSATATNKITIIFKAHHECTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLR
IVERESGHYVEMHARYIGTTVFVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPLS
ERIDDGQGQVSAILGHSLPRTSLVQAWPGYTLETANTQCHEKMPVKDIYFQSCVFDLLTT
GDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSLGLTCLILIVFL
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgataaggaagaagaggaagcgaagcgcgccccccggcccatgccgcagccacgggccc
agacccgccacggcgcccgcgccgccgccctcgccggagcccacgagacctgcatggacg
ggcatgggcttgagagcagcaccttccagcgccgccgctgccgccgccgaggttgagcag
cgccgcagccccgggctctgccccccgccgctggagctgctgctgctgctgctgttcagc
ctcgggctgctccacgcaggtgactgccaacagccagcccaatgtcgaatccagaaatgc
accacggacttcgtgtccctgacttctcacctgaactctgccgttgacggctttgactct
gagttttgcaaggccttgcgtgcctatgctggctgcacccagcgaacttcaaaagcctgc
cgtggcaacctggtataccattctgccgtgttgggtatcagtgacctcatgagccagagg
aattgttccaaggatggacccacatcctctaccaaccccgaagtgacccatgatccttgc
aactatcacagccacgctggagccagggaacacaggagaggggaccagaaccctcccagt
taccttttttgtggcttgtttggagatcctcacctcagaactttcaaggataacttccaa
acatgcaaagtagaaggggcctggccactcatagataataattatctttcagttcaagtg
acaaacgtacctgtggtccctggatccagtgctactgctacaaataagatcactattatc
ttcaaagcccaccatgagtgtacagatcagaaagtctaccaagctgtgacagatgacctg
ccggccgcctttgtggatggcaccaccagtggtggggacagcgatgccaagagcctgcgt
atcgtggaaagggagagtggccactatgtggagatgcacgcccgctatatagggaccaca
gtgtttgtgcggcaggtgggtcgctacctgacccttgccatccgtatgcctgaagacctg
gccatgtcctacgaggagagccaggacctgcagctgtgcgtgaacggctgccccctgagt
gaacgcatcgatgacgggcagggccaggtgtctgccatcctgggacacagcctgcctcgc
acctccttggtgcaggcctggcctggctacacactggagactgccaacactcaatgccat
gagaagatgccagtgaaggacatctatttccagtcctgtgtcttcgacctgctcaccact
ggtgatgccaactttactgccgcagcccacagtgccttggaggatgtggaggccctgcac
ccaaggaaggaacgctggcacattttccccagcagtggcaatgggactccccgtggaggc
agtgatttgtctgtcagtctaggactcacctgcttgatccttatcgtgtttttgtag

DBGET integrated database retrieval system