KEGG   Homo sapiens (human): 285755Help
Entry
285755            CDS       T01001                                 

Gene name
PPIL6, PPIase, RSPH12, bA425D10.6, dJ919F19.1
Definition
(RefSeq) peptidylprolyl isomerase like 6
  KO
K12739  peptidyl-prolyl cis-trans isomerase-like 6 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    285755 (PPIL6)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     285755 (PPIL6)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    285755 (PPIL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 285755
NCBI-ProteinID: NP_775943
HGNC: 21557
Ensembl: ENSG00000185250
Vega: OTTHUMG00000036593
Pharos: Q8IXY8(Tdark)
UniProt: Q8IXY8
Position
6q21
AA seq 311 aa AA seqDB search
MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPIL
VPLQEFAWHQYLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKP
SALYDALTEDFSAKFLRDTKHDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTG
KAGFSQRGIRLHYKNSIFHRIVQNGWIQGGDIVYGKGDNGESIYGPTFEDENFSVPHNKR
GVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPIHM
CRITDSGDPYA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggccgcagccgtgcgggcccccgcacgctaggtgcggctcgccgtcgctgccg
gagcggccgctgcaggtgaaggtggtggggctcttcagctgccccaactttcagattgcg
aagagcgccgctgagaatctgaagaataatcatccatccaaatttgaagatcctatatta
gttcctcttcaagaatttgcatggcatcaatatctacaggagaaaaaaagggaactcaaa
aatgaaacctgggaatattcttcctctgtgatttcttttgttaatggtcagtttctgggt
gatgcattggatctgcagaaatgggcccacgaggtgtgggatatagttgacattaaaccc
tctgcactttatgacgcactcactgaggatttttccgctaagttcttaagagacaccaag
catgatttcgtgtttttggacatttgtattgattcttctccaattggaagattgattttt
gagctatactgtgatgtgtgtcccaaaacatgtaaaaattttcaggtcttgtgcacagga
aaagcagggttttctcaacgtggcataagactacattacaaaaattccatttttcatcga
atagtacagaatggctggatacaaggaggggatatagtgtatggaaaaggagataatgga
gagtcgatttatggtccaacatttgaagatgaaaacttttcagttcctcataataaaaga
ggagtacttggaatggccaacaaaggccgtcacagcaacgggtcacaattctatatcaca
ctgcaagcaactccttatctagatagaaaatttgtggcttttgggcaactgattgaagga
acagaagtgcttaaacaactagaattagttccaacacagaatgaaagaccaatacatatg
tgtagaattactgacagtggagatccttatgcttga

DBGET integrated database retrieval system