KEGG   Homo sapiens (human): 285800
Entry
285800            CDS       T01001                                 
Symbol
PRR18
Name
(RefSeq) proline rich 18
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PRR18
Other DBs
NCBI-GeneID: 285800
NCBI-ProteinID: NP_787118
HGNC: 28574
Ensembl: ENSG00000176381
Vega: OTTHUMG00000167034
Pharos: Q8N4B5(Tdark)
UniProt: Q8N4B5
Position
6:complement(166305300..166308392)
AA seq 295 aa
MPFPPMPPPPAPAPGAQAARQLPRRPCAAGDKKKRPPQRPEGLLSSSWPSATLKRPPARR
GPGLDRTQPPAPPGVSPQALPSRARAPATCAPPRPAGSGHSPARTTYAATSAGTGTTAAG
TSSGAGPCPDSAARFCLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLP
ARAAGPRRGGPASDPDAPPTAGQGRRAPPPGAQLLHGGLQVPQLSPRPGALRPMLKVSLL
NERHRYDDVEYEEEPEAVDEGLVRKCTEWLRGVESAAAARGRAGALDSRRHLSTL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcccttcccgcccatgccgccgccgcccgcccccgccccgggggcccaagccgcgcgc
cagttaccccggaggccctgcgccgcgggggacaagaagaagaggcccccacagcggccc
gaggggctcctctccagctcctggccctccgccacgctcaagaggccgccggcccggcgc
ggccccggcctggacaggacgcagccgccggcccctccgggcgtctccccccaggccttg
cccagccgcgcgcgggccccagccacgtgcgccccgccccggccggcaggctccggccac
agcccagcgaggaccacctatgcggcgacctcggcggggacggggaccaccgccgcgggc
acctcctcgggggcggggccttgtccagactccgctgcgcgcttctgcctgaatctcacc
cccgaggccgtcctggtcatccagaagcgtcatctggagaagcagctgctggcgcggccc
cgcaggcccttcccctcaccctcggccgaacccaggcgcctactcgccccgtgtctcccg
gctagggccgcgggcccgcggaggggcggccccgccagcgaccccgacgcaccccccacc
gccggccagggccgccgcgcgcctccgcccggcgcccagctgctgcacggcggcctgcag
gttccccagctcagcccgcggcccggggccctgcggccgatgctcaaggtgtcgctgctc
aacgagcggcacaggtacgacgacgtggagtacgaggaggagccagaggcggtggacgag
ggcctggtacgcaagtgcacggagtggctgcgcggcgtggagtccgcggctgccgcgcgg
ggccgggcgggggccctggactcacggcggcacctgagcacgctgtga

DBGET integrated database retrieval system