KEGG   Homo sapiens (human): 285852
Entry
285852            CDS       T01001                                 

Gene name
TREML4, TLT-4, TLT4
Definition
(RefSeq) triggering receptor expressed on myeloid cells like 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: V-set ig
Other DBs
NCBI-GeneID: 285852
NCBI-ProteinID: NP_937796
OMIM: 614664
HGNC: 30807
Ensembl: ENSG00000188056
Vega: OTTHUMG00000016408
Pharos: Q6UXN2(Tdark)
UniProt: Q6UXN2
Position
6p21.1
AA seq 200 aa
MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSP
SRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIIT
VLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG
GPRFLVLVLCGLLLAKGLML
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcctggggtggggtccacacctgctgcttccacctgtgctgctgctgctcctggcct
cagggtgctgtgcctgaagaacttcacaaacacccaggacagaccctcctcctgcaatgc
cagtactcacccaagagagggccctatcagcccaaatcctggtgtcagcagacatctcca
agtcggtgtaccttacttgtcaccagctccaagccctggacagcagttcagaagtctcat
tacacaatctgggacaagcccaatgctggcttcttcaacatcaccatgattcagctgaca
cagaatgactcgggattctactggtgtggaatctacaacgcttccgaaaacatcatcact
gttcttagaaatatcagcctggtggtgtctccagccccaaccacgtctcctatgtggact
cttccctggctcccaacaagcacagttctgatcacttctccagaggggacctctggccat
ccctccatcaatggctctgagaccaggaaatcaagagcccctgcctgccttggctcaggt
ggccccagattcctggtcttggtgctatgtggactcctcctggccaagggcctgatgttg
tga

DBGET integrated database retrieval system