KEGG   Homo sapiens (human): 2859Help
Entry
2859              CDS       T01001                                 

Gene name
GPR35
Definition
(RefSeq) G protein-coupled receptor 35
  KO
K04276  C-X-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2859 (GPR35)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2859 (GPR35)
   04050 Cytokine receptors [BR:hsa04050]
    2859 (GPR35)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    2859 (GPR35)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   2859 (GPR35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 2859
NCBI-ProteinID: NP_005292
OMIM: 602646
HGNC: 4492
Ensembl: ENSG00000178623
Vega: OTTHUMG00000133356
Pharos: Q9HC97(Tchem)
UniProt: Q9HC97 A8K2J1 B2RA17
Position
2q37.3
AA seq 309 aa AA seqDB search
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcacctacaacacctgtggctccagcgacctcacctggcccccagcgatcaag
ctgggcttctacgcctacttgggcgtcctgctggtgctaggcctgctgctcaacagcctg
gcgctctgggtgttctgctgccgcatgcagcagtggacggagacccgcatctacatgacc
aacctggcggtggccgacctctgcctgctgtgcaccttgcccttcgtgctgcactccctg
cgagacacctcagacacgccgctgtgccagctctcccagggcatctacctgaccaacagg
tacatgagcatcagcctggtcacggccatcgccgtggaccgctatgtggccgtgcggcac
ccgctgcgtgcccgcgggctgcggtcccccaggcaggctgcggccgtgtgcgcggtcctc
tgggtgctggtcatcggctccctggtggctcgctggctcctggggattcaggagggcggc
ttctgcttcaggagcacccggcacaatttcaactccatggcgttcccgctgctgggattc
tacctgcccctggccgtggtggtcttctgctccctgaaggtggtgactgccctggcccag
aggccacccaccgacgtggggcaggcagaggccacccgcaaggctgcccgcatggtctgg
gccaacctcctggtgttcgtggtctgcttcctgcccctgcacgtggggctgacagtgcgc
ctcgcagtgggctggaacgcctgtgccctcctggagacgatccgtcgcgccctgtacata
accagcaagctctcagatgccaactgctgcctggacgccatctgctactactacatggcc
aaggagttccaggaggcgtctgcactggccgtggctcccagtgctaaggcccacaaaagc
caggactctctgtgcgtgaccctcgcctaa

DBGET integrated database retrieval system