KEGG   Homo sapiens (human): 285971Help
Entry
285971            CDS       T01001                                 

Gene name
ZNF775
Definition
(RefSeq) zinc finger protein 775
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 DZR DUF3268 MBD zf-C2H2_11 zf-Di19 HypA zf-C2H2_jaz zf-LYAR zf-H2C2_5 zf-C2HC_2 zinc_ribbon_9
Motif
Other DBs
NCBI-GeneID: 285971
NCBI-ProteinID: NP_775951
HGNC: 28501
Ensembl: ENSG00000196456
Vega: OTTHUMG00000191597
Pharos: Q96BV0(Tdark)
UniProt: Q96BV0
Position
7q36.1
AA seq 537 aa AA seqDB search
MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRP
RALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWS
SLKIHQRTHTGEKPYLCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLK
HQKTHSRPATHSCPECERCFRHQVGLRIHQRAHARDRQGSRAGLHELIQDAAARRACRLQ
PGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQFICNECGKSFTWWSSLNIHQ
RIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHL
PGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQ
RSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECG
RRFSQKPNLTRHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggcctggctggcaacggcacaggagctgggctggtgatgaaggtcaagcag
gagaagccggagcggctgctgcagacgctggcgccgcaggccatgcttgtggagaaggac
aaggagaacatatttcagcagcaccggggcctcccgccacgccagaccatggggcggcct
cgagccctggggggacaggaggagtctgggagtccaaggtgggcccctcccactgagcag
gatgcggggctggcaggccgggctcccgggtcagcctccggccccctgagcccctcgctt
tcctccggcgagggtcactttgtatgcctggactgcgggaagaggttcagctggtggtcg
tccctgaagatccaccagcgcacccacaccggggagaagccgtacctctgcggcaagtgc
ggcaagagcttcagccagaagccgaacctggcgcgccaccagcggcaccacacgggcgag
cgacccttctgctgccccgagtgcgcgcggcgcttcagccagaagcagcacctgctcaag
caccagaagacccactcccggcccgccacccactcgtgccccgagtgcgagcgctgcttc
cgtcaccaggtgggcctccgcatccaccagcgcgcgcacgcccgggaccgccagggctcc
cgcgccggcctgcacgagctgattcaggacgcggcggcgcgccgggcctgtcgcctgcag
ccggggccgccgcgggggcgccccgagtgggcctggctggggctctgccagggctggtgg
ggccagcccggggcccgggccgcggtctccggccccgaggggccgggcgagccgcgccag
ttcatctgcaacgagtgtggcaagagcttcacctggtggtcgtcgctgaacatccaccag
cgcatccacactggcgagcgcccctatgcgtgccccgagtgcggccgccgcttcagccag
aagcccaacttgacgcggcacctgcgcaaccacacaggcgagcgcccgcacccctgcccg
cactgtggccgcggcttccgccagaagcagcacctgctcaagcacctgcgcacgcacctg
cccggcgcccaggctgcgccctgccccagctgcggtaagagctgccgcagccgcgccgcg
ctgcgcgcccaccagcgcgcccacgctgtcgctgagcccgccgttccggccggggaaccg
ggcgaccagccgcaggccgaggccatcccgggcttggccgcgaggccgcggagctcccaa
cggtccccgggggcccgggacacgctgtggggccggggacaagcgggcctcgctgggcct
ggcgagccgcgccagttcatctgcaacgagtgcggcaagagcttctcgtggtggtcggcg
ctcaccatccaccagcgcatccacacgggtgagcggccctacccgtgccccgagtgcggc
cgccgcttcagccagaagcccaacctgacgcggcaccggcgcaaccacacaggcgagcgg
ccctacctgtgtcccgcctgcggccgcggcttcagccagaagcagcacctgctcaagcac
cagcgcgtgcaccgcgcggcccctgcgtgcagccccaaggaggaggcgcgctag

DBGET integrated database retrieval system