KEGG   Homo sapiens (human): 285973Help
Entry
285973            CDS       T01001                                 

Gene name
ATG9B, APG9L2, NOS3AS, SONE
Definition
(RefSeq) autophagy related 9B
  KO
K17907  autophagy-related protein 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    285973 (ATG9B)
   04136 Autophagy - other
    285973 (ATG9B)
   04137 Mitophagy - animal
    285973 (ATG9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    285973 (ATG9B)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    285973 (ATG9B)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    285973 (ATG9B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    285973 (ATG9B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    285973 (ATG9B)
Transporters [BR:hsa02000]
 Other transporters
  Others
   285973 (ATG9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG9
Motif
Other DBs
NCBI-GeneID: 285973
NCBI-ProteinID: NP_001303985
OMIM: 612205
HGNC: 21899
Ensembl: ENSG00000181652
Vega: OTTHUMG00000158634
Pharos: Q674R7(Tbio)
UniProt: Q674R7
Position
7q36.1
AA seq 924 aa AA seqDB search
MVSRMGWGGRRRRLGRWGDLGPGSVPLLPMPLPPPPPPSCRGPGGGRISIFSLSPAPHTR
SSPSSFSPPTAGPPCSVLQGTGASQSCHSALPIPATPPTQAQPAMTPASASPSWGSHSTP
PLAPATPTPSQQCPQDSPGLRVGPLIPEQDYERLEDCDPEGSQDSPIHGEEQQPLLHVPE
GLRGSWHHIQNLDSFFTKIYSYHQRNGFACILLEDVFQLGQFIFIVTFTTFLLRCVDYNV
LFANQPSNHTRPGPFHSKVTLSDAILPSAQCAERIRSSPLLVLLLVLAAGFWLVQLLRSV
CNLFSYWDIQVFYREALHIPPEELSSVPWAEVQSRLLALQRSGGLCVQPRPLTELDIHHR
ILRYTNYQVALANKGLLPARCPLPWGGSAAFLSRGLALNVDLLLFRGPFSLFRGGWELPH
AYKRSDQRGALAARWGRTVLLLAALNLALSPLVLAWQVLHVFYSHVELLRREPGALGARG
WSRLARLQLRHFNELPHELRARLARAYRPAAAFLRTAAPPAPLRTLLARQLVFFAGALFA
ALLVLTVYDEDVLAVEHVLTAMTALGVTATVARSFIPEEQCQGRAPQLLLQTALAHMHYL
PEEPGPGGRDRAYRQMAQLLQYRAVSLLEELLSPLLTPLFLLFWFRPRALEIIDFFHHFT
VDVAGVGDICSFALMDVKRHGHPQWLSAGQTEASLSQRAEDGKTELSLMRFSLAHPLWRP
PGHSSKFLGHLWGRVQQDAAAWGATSARGPSTPGVLSNCTSPLPEAFLANLFVHPLLPPR
DLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPELASAEMSLHVIYLHQ
LHQQQQQQEPWGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKAR
NLFPGGFQVTTDTQKEPDRASCTD
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggtgagccgaatgggctggggggggagaagaaggcggctggggcggtggggagatctg
gggcccggatcggtgcccctcctccccatgccactgccacctcctcctcctccttcatgc
cggggacctgggggagggaggatctccatcttctctctgtcccctgcccctcatacaaga
agctccccctcctcattttcccctcccaccgcagggcccccttgctcagtgctacagggg
acaggggcttctcagtcttgccacagtgctctccctatcccagccacccccccaacacag
gctcaacctgcaatgacacctgcctctgcatctccctcctggggatcccactccacccca
cccctggccccggcaacccccactccctcacagcagtgcccccaggactctcctgggctg
cgggtaggccctttgatccctgaacaggattatgagcggctggaggactgtgaccctgag
gggtcccaagactcacccatccacggggaggagcagcaacccctgcttcatgtccctgaa
gggctccgaggctcctggcatcacatccagaacctggacagtttcttcaccaagatctac
agctaccaccagcggaatggctttgcctgcatcttgctggaggatgtcttccagctggga
caatttattttcattgtcaccttcacaaccttcctccttcgatgcgtggattacaatgtt
ctctttgccaaccaaccaagtaaccataccagacctgggccgttccacagcaaagtgacc
ctgtcagatgccatcctaccctcagcccagtgtgctgagaggatccgctccagcccgctg
ctggtcctcctcctggtcctggctgccggcttctggctggtccaactgcttcgctcagtc
tgcaacctcttcagctactgggacatccaggtgttttacagggaggccctgcacatcccc
ccggaggagctgagctcggttccctgggcagaggtgcagtcccgcctcttggcactgcag
cggagcgggggcctgtgcgtgcagccgcggcccctgacggagctggacatccaccaccgc
atcctgcgctacaccaactaccaggtggcgctggccaacaaaggcctgctgccggcccgc
tgcccgctgccctggggaggcagtgcggctttcctcagccgcggcctggcgctcaatgtc
gacctgctgctcttccgcggtcccttctcgctcttccgcgggggctgggagctgccgcac
gcctacaagcgcagcgaccagcggggcgccctagcagcgcgctgggggcgcacagtgctg
ctgctggccgccctgaacctggcgctgagcccgctggtgctggcctggcaggttctgcac
gtcttctatagccacgtggagctgctgcggcgcgagcctggcgcgctgggggcgcgcggc
tggtcccgcctggcgcgcttgcagctgcgccacttcaacgagctgccgcacgagctgcgc
gcgcgcctggcccgcgcctaccgccccgccgccgccttcctgcgcaccgctgcgcccccc
gcgcccctgcgcacgctgctggcccgccagctcgttttcttcgcgggtgcactcttcgcc
gcgctgcttgtgctcaccgtctacgacgaggacgtgctagccgtggagcacgtgctcacc
gccatgaccgcgctcggggtcaccgccaccgtcgccaggtctttcattccggaagagcag
tgccagggtcgtgcgccgcagctcctgctgcagacagccctggcccacatgcactacctc
ccggaggagcccggccccggcggcagggaccgcgcctaccggcagatggcgcagctgctg
cagtaccgagcggtctccctcctggaggagctcctgtccccgctcctcaccccgctgttt
ctgcttttctggttccgccctcgtgccctggagattatcgacttttttcatcacttcact
gtggatgtggctggggttggggacatctgttcctttgcccttatggatgtgaagcgccac
ggacaccctcagtggctctcggcgggacagactgaggcctcgctgtctcagcgtgcggag
gacggcaagactgagctttctttgatgcggttctccctggcgcatccactctggcgcccc
ccagggcacagctctaagtttcttgggcacctctggggccgagtacaacaagatgcagct
gcctggggtgccacctcggctcgcggcccctccaccccgggggtgctcagcaactgcacc
tcgcccctgcctgaggccttcctggccaacctcttcgtgcaccctctcctgcctccgaga
gatctgagcccgacagccccctgtccagctgcggccacagccagcctccttgcctccatt
tcccgaattgcccaggaccccagctctgtgtccccaggaggcactgggggccagaagctg
gcccagctcccagaacttgcttctgccgagatgagtctccatgtcatctacctgcaccag
cttcaccagcagcagcagcagcaggagccgtggggtgaggctgcagcctccatcctgtcc
aggccctgctccagcccctcacagccaccctcgcctgatgaggagaagccatcctggtca
agtgacggctccagtcctgcctctagccccagacaacagtggggaacccagaaggcccgg
aatctgttccccggagggtttcaggtgaccacagacacccagaaggagcctgaccgggcc
tcttgcactgactga

DBGET integrated database retrieval system